Showing content from https://patents.google.com/patent/US9670493B2/en below:
US9670493B2 - Low-phosphate repressible promoter
US9670493B2 - Low-phosphate repressible promoter - Google PatentsLow-phosphate repressible promoter Download PDF Info
-
Publication number
-
US9670493B2
US9670493B2 US14/773,554 US201414773554A US9670493B2 US 9670493 B2 US9670493 B2 US 9670493B2 US 201414773554 A US201414773554 A US 201414773554A US 9670493 B2 US9670493 B2 US 9670493B2
-
Authority
-
US
-
United States
-
Prior art keywords
-
promoter
-
sequence
-
gene
-
phosphate
-
seq
-
Prior art date
-
2013-03-14
-
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
-
Active, expires 2034-05-11
Application number
US14/773,554
Other versions
US20160017342A1 (en
Inventor
Fernando Valle
Patricia Choudhary
Robert Osborne
Saul Nitsche Rocha
Monica Bhatia
U Loi Lao
Yihui Zhu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Codexis Inc
Original Assignee
Codexis Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
2013-03-14
Filing date
2014-03-13
Publication date
2017-06-06
2014-03-13 Application filed by Codexis Inc filed Critical Codexis Inc
2014-03-13 Priority to US14/773,554 priority Critical patent/US9670493B2/en
2014-06-19 Assigned to CODEXIS, INC. reassignment CODEXIS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: ZHU, YIHUI, CHOUDHARY, Patricia, ROCHA, SAUL NITSCHE, LAO, U Loi, BHATIA, MONICA, VALLE, FERNANDO, OSBORNE, ROBERT
2016-01-21 Publication of US20160017342A1 publication Critical patent/US20160017342A1/en
2017-06-06 Application granted granted Critical
2017-06-06 Publication of US9670493B2 publication Critical patent/US9670493B2/en
2024-02-15 Assigned to INNOVATUS LIFE SCIENCES LENDING FUND I, LP, AS COLLATERAL AGENT reassignment INNOVATUS LIFE SCIENCES LENDING FUND I, LP, AS COLLATERAL AGENT SECURITY INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: CODEXIS, INC.
Status Active legal-status Critical Current
2034-05-11 Adjusted expiration legal-status Critical
Links
- 229910019142 PO4 Inorganic materials 0.000 title claims abstract description 73
- 239000010452 phosphate Substances 0.000 title claims abstract description 73
- 241000588724 Escherichia coli Species 0.000 claims abstract description 42
- 108090000623 proteins and genes Proteins 0.000 claims description 153
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 claims description 48
- 230000014509 gene expression Effects 0.000 claims description 46
- 101100115751 Trypanosoma brucei brucei dnaaf11 gene Proteins 0.000 claims description 38
- 239000001963 growth medium Substances 0.000 claims description 21
- 238000000034 method Methods 0.000 abstract description 57
- 239000000203 mixture Substances 0.000 abstract description 19
- 210000004027 cell Anatomy 0.000 description 95
- 235000001014 amino acid Nutrition 0.000 description 68
- 108090000765 processed proteins & peptides Proteins 0.000 description 68
- 102000004196 processed proteins & peptides Human genes 0.000 description 63
- 229940024606 amino acid Drugs 0.000 description 60
- 150000001413 amino acids Chemical class 0.000 description 58
- 229920001184 polypeptide Polymers 0.000 description 57
- 108020004414 DNA Proteins 0.000 description 55
- 102000053602 DNA Human genes 0.000 description 53
- 150000007523 nucleic acids Chemical class 0.000 description 43
- 239000000047 product Substances 0.000 description 42
- 238000003752 polymerase chain reaction Methods 0.000 description 41
- 102000040430 polynucleotide Human genes 0.000 description 41
- 108091033319 polynucleotide Proteins 0.000 description 41
- 239000002157 polynucleotide Substances 0.000 description 41
- 150000002191 fatty alcohols Chemical class 0.000 description 32
- 102000004169 proteins and genes Human genes 0.000 description 32
- 235000018102 proteins Nutrition 0.000 description 30
- 102000004190 Enzymes Human genes 0.000 description 28
- 108090000790 Enzymes Proteins 0.000 description 28
- 101150015067 fabB gene Proteins 0.000 description 28
- 102000039446 nucleic acids Human genes 0.000 description 28
- 108020004707 nucleic acids Proteins 0.000 description 28
- 230000037430 deletion Effects 0.000 description 27
- 238000012217 deletion Methods 0.000 description 27
- 229940088598 enzyme Drugs 0.000 description 27
- 125000003729 nucleotide group Chemical group 0.000 description 27
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 26
- 230000035772 mutation Effects 0.000 description 25
- 239000002773 nucleotide Substances 0.000 description 24
- 239000013612 plasmid Substances 0.000 description 24
- 244000005700 microbiome Species 0.000 description 23
- 108091028043 Nucleic acid sequence Proteins 0.000 description 22
- 238000013518 transcription Methods 0.000 description 22
- 230000035897 transcription Effects 0.000 description 22
- 238000006243 chemical reaction Methods 0.000 description 20
- 238000006467 substitution reaction Methods 0.000 description 20
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 19
- 238000004519 manufacturing process Methods 0.000 description 18
- 230000012010 growth Effects 0.000 description 17
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 16
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 15
- 108091034117 Oligonucleotide Proteins 0.000 description 15
- 238000007792 addition Methods 0.000 description 15
- 125000003275 alpha amino acid group Chemical group 0.000 description 15
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 15
- 230000000694 effects Effects 0.000 description 15
- 238000000855 fermentation Methods 0.000 description 15
- 230000004151 fermentation Effects 0.000 description 15
- 229960001031 glucose Drugs 0.000 description 15
- 230000004048 modification Effects 0.000 description 15
- 238000012986 modification Methods 0.000 description 15
- 229920002477 rna polymer Polymers 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 14
- 210000000349 chromosome Anatomy 0.000 description 14
- 238000002474 experimental method Methods 0.000 description 14
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 13
- 229910052799 carbon Inorganic materials 0.000 description 13
- 150000001875 compounds Chemical class 0.000 description 13
- 238000012258 culturing Methods 0.000 description 13
- 239000008103 glucose Substances 0.000 description 13
- 238000003780 insertion Methods 0.000 description 13
- 230000037431 insertion Effects 0.000 description 13
- 229930027917 kanamycin Natural products 0.000 description 13
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 13
- 229960000318 kanamycin Drugs 0.000 description 13
- 229930182823 kanamycin A Natural products 0.000 description 13
- 230000001105 regulatory effect Effects 0.000 description 13
- 230000015572 biosynthetic process Effects 0.000 description 12
- 108020004999 messenger RNA Proteins 0.000 description 12
- 240000008042 Zea mays Species 0.000 description 11
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 11
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 11
- 239000000872 buffer Substances 0.000 description 11
- 235000005822 corn Nutrition 0.000 description 11
- 101150078207 fabA gene Proteins 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 239000002609 medium Substances 0.000 description 11
- 230000008569 process Effects 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- 239000000126 substance Substances 0.000 description 11
- 108091026890 Coding region Proteins 0.000 description 10
- 102100031780 Endonuclease Human genes 0.000 description 10
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 10
- 230000003321 amplification Effects 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 10
- 230000001580 bacterial effect Effects 0.000 description 10
- 238000003199 nucleic acid amplification method Methods 0.000 description 10
- 239000000758 substrate Substances 0.000 description 10
- 230000002103 transcriptional effect Effects 0.000 description 10
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 9
- 239000006142 Luria-Bertani Agar Substances 0.000 description 9
- 238000010276 construction Methods 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- 241000894006 Bacteria Species 0.000 description 8
- 101100173127 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) fabZ gene Proteins 0.000 description 8
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 8
- 238000011529 RT qPCR Methods 0.000 description 8
- 239000003550 marker Substances 0.000 description 8
- 230000007246 mechanism Effects 0.000 description 8
- 101150099106 pstS gene Proteins 0.000 description 8
- 239000013598 vector Substances 0.000 description 8
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 7
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 239000000411 inducer Substances 0.000 description 7
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 7
- 238000002703 mutagenesis Methods 0.000 description 7
- 231100000350 mutagenesis Toxicity 0.000 description 7
- 239000008188 pellet Substances 0.000 description 7
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 7
- 230000014616 translation Effects 0.000 description 7
- OSNSWKAZFASRNG-WNFIKIDCSA-N (2s,3r,4s,5s,6r)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol;hydrate Chemical compound O.OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@@H]1O OSNSWKAZFASRNG-WNFIKIDCSA-N 0.000 description 6
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 6
- 108010053770 Deoxyribonucleases Proteins 0.000 description 6
- 102000016911 Deoxyribonucleases Human genes 0.000 description 6
- -1 ELISA Proteins 0.000 description 6
- 108091092195 Intron Proteins 0.000 description 6
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- 229940041514 candida albicans extract Drugs 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- SNRUBQQJIBEYMU-UHFFFAOYSA-N dodecane Chemical compound CCCCCCCCCCCC SNRUBQQJIBEYMU-UHFFFAOYSA-N 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 239000012527 feed solution Substances 0.000 description 6
- 238000002290 gas chromatography-mass spectrometry Methods 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 235000019341 magnesium sulphate Nutrition 0.000 description 6
- 235000019796 monopotassium phosphate Nutrition 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 238000003786 synthesis reaction Methods 0.000 description 6
- 238000013519 translation Methods 0.000 description 6
- 238000011144 upstream manufacturing Methods 0.000 description 6
- 239000012138 yeast extract Substances 0.000 description 6
- NTIZESTWPVYFNL-UHFFFAOYSA-N Methyl isobutyl ketone Chemical compound CC(C)CC(C)=O NTIZESTWPVYFNL-UHFFFAOYSA-N 0.000 description 5
- UIHCLUNTQKBZGK-UHFFFAOYSA-N Methyl isobutyl ketone Natural products CCC(C)C(C)=O UIHCLUNTQKBZGK-UHFFFAOYSA-N 0.000 description 5
- XCOBLONWWXQEBS-KPKJPENVSA-N N,O-bis(trimethylsilyl)trifluoroacetamide Chemical compound C[Si](C)(C)O\C(C(F)(F)F)=N\[Si](C)(C)C XCOBLONWWXQEBS-KPKJPENVSA-N 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 230000001186 cumulative effect Effects 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 238000011156 evaluation Methods 0.000 description 5
- 238000012239 gene modification Methods 0.000 description 5
- 238000010353 genetic engineering Methods 0.000 description 5
- 230000005017 genetic modification Effects 0.000 description 5
- 235000013617 genetically modified food Nutrition 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 230000010076 replication Effects 0.000 description 5
- 230000035945 sensitivity Effects 0.000 description 5
- 239000001509 sodium citrate Substances 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 4
- 102220489110 Melanoma-associated antigen 1_D56S_mutation Human genes 0.000 description 4
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 4
- 230000002378 acidificating effect Effects 0.000 description 4
- 125000001931 aliphatic group Chemical group 0.000 description 4
- 230000003698 anagen phase Effects 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 4
- 229960005091 chloramphenicol Drugs 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 229930182830 galactose Natural products 0.000 description 4
- 238000002744 homologous recombination Methods 0.000 description 4
- 230000006801 homologous recombination Effects 0.000 description 4
- 238000009396 hybridization Methods 0.000 description 4
- 230000002209 hydrophobic effect Effects 0.000 description 4
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 230000000977 initiatory effect Effects 0.000 description 4
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 4
- 102200133062 rs144917638 Human genes 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 4
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 4
- 229960000268 spectinomycin Drugs 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 230000001131 transforming effect Effects 0.000 description 4
- 150000004670 unsaturated fatty acids Chemical class 0.000 description 4
- 235000021122 unsaturated fatty acids Nutrition 0.000 description 4
- 229910052720 vanadium Inorganic materials 0.000 description 4
- 241000972773 Aulopiformes Species 0.000 description 3
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 3
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 3
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 3
- 101100390711 Escherichia coli (strain K12) fhuA gene Proteins 0.000 description 3
- 108700024394 Exon Proteins 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 102000018120 Recombinases Human genes 0.000 description 3
- 108010091086 Recombinases Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 101150014383 adhE gene Proteins 0.000 description 3
- 235000019270 ammonium chloride Nutrition 0.000 description 3
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 3
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 3
- 125000003118 aryl group Chemical group 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000002759 chromosomal effect Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 3
- 235000019797 dipotassium phosphate Nutrition 0.000 description 3
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 3
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 3
- 101150077341 fhuA gene Proteins 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 239000002054 inoculum Substances 0.000 description 3
- 230000010354 integration Effects 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 125000005647 linker group Chemical group 0.000 description 3
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 230000002018 overexpression Effects 0.000 description 3
- 229910052698 phosphorus Inorganic materials 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000011002 quantification Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 235000019515 salmon Nutrition 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- HRNGDAQBEIFYGL-UHFFFAOYSA-N 3,4-dihydroxy-4-tetradeca-3,6-dienoyloxybutanoic acid Chemical compound CCCCCCCC=CCC=CCC(=O)OC(O)C(O)CC(O)=O HRNGDAQBEIFYGL-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 2
- 239000002028 Biomass Substances 0.000 description 2
- 101100268670 Caenorhabditis elegans acc-3 gene Proteins 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 108010067770 Endopeptidase K Proteins 0.000 description 2
- 108010046276 FLP recombinase Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 101000881131 Homo sapiens RNA/RNP complex-1-interacting phosphatase Proteins 0.000 description 2
- 102000004195 Isomerases Human genes 0.000 description 2
- 108090000769 Isomerases Proteins 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- BZLVMXJERCGZMT-UHFFFAOYSA-N Methyl tert-butyl ether Chemical compound COC(C)(C)C BZLVMXJERCGZMT-UHFFFAOYSA-N 0.000 description 2
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 2
- IMNFDUFMRHMDMM-UHFFFAOYSA-N N-Heptane Chemical class CCCCCCC IMNFDUFMRHMDMM-UHFFFAOYSA-N 0.000 description 2
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 240000007594 Oryza sativa Species 0.000 description 2
- 235000007164 Oryza sativa Nutrition 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000006335 Phosphate-Binding Proteins Human genes 0.000 description 2
- 108010058514 Phosphate-Binding Proteins Proteins 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 229920001131 Pulp (paper) Polymers 0.000 description 2
- 102100037566 RNA/RNP complex-1-interacting phosphatase Human genes 0.000 description 2
- 238000011530 RNeasy Mini Kit Methods 0.000 description 2
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 101100398785 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) ldhD gene Proteins 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 101100386830 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) ddh gene Proteins 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 2
- 229910021529 ammonia Inorganic materials 0.000 description 2
- 239000000908 ammonium hydroxide Substances 0.000 description 2
- 239000012378 ammonium molybdate tetrahydrate Substances 0.000 description 2
- 235000011130 ammonium sulphate Nutrition 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- FRHBOQMZUOWXQL-UHFFFAOYSA-K azane;2-hydroxypropane-1,2,3-tricarboxylate;iron(3+) Chemical compound N.[Fe+3].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O FRHBOQMZUOWXQL-UHFFFAOYSA-K 0.000 description 2
- FIXLYHHVMHXSCP-UHFFFAOYSA-H azane;dihydroxy(dioxo)molybdenum;trioxomolybdenum;tetrahydrate Chemical compound N.N.N.N.N.N.O.O.O.O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O=[Mo](=O)=O.O[Mo](O)(=O)=O.O[Mo](O)(=O)=O.O[Mo](O)(=O)=O FIXLYHHVMHXSCP-UHFFFAOYSA-H 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 235000013339 cereals Nutrition 0.000 description 2
- GFHNAMRJFCEERV-UHFFFAOYSA-L cobalt chloride hexahydrate Chemical compound O.O.O.O.O.O.[Cl-].[Cl-].[Co+2] GFHNAMRJFCEERV-UHFFFAOYSA-L 0.000 description 2
- 238000010960 commercial process Methods 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- JZCCFEFSEZPSOG-UHFFFAOYSA-L copper(II) sulfate pentahydrate Chemical compound O.O.O.O.O.[Cu+2].[O-]S([O-])(=O)=O JZCCFEFSEZPSOG-UHFFFAOYSA-L 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 229960000633 dextran sulfate Drugs 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- CDMADVZSLOHIFP-UHFFFAOYSA-N disodium;3,7-dioxido-2,4,6,8,9-pentaoxa-1,3,5,7-tetraborabicyclo[3.3.1]nonane;decahydrate Chemical compound O.O.O.O.O.O.O.O.O.O.[Na+].[Na+].O1B([O-])OB2OB([O-])OB1O2 CDMADVZSLOHIFP-UHFFFAOYSA-N 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 238000010362 genome editing Methods 0.000 description 2
- KWIUHFFTVRNATP-UHFFFAOYSA-N glycine betaine Chemical compound C[N+](C)(C)CC([O-])=O KWIUHFFTVRNATP-UHFFFAOYSA-N 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 239000004313 iron ammonium citrate Substances 0.000 description 2
- 235000000011 iron ammonium citrate Nutrition 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 238000011005 laboratory method Methods 0.000 description 2
- 101150026107 ldh1 gene Proteins 0.000 description 2
- 101150041530 ldha gene Proteins 0.000 description 2
- OQTQHQORDRKHFW-UHFFFAOYSA-L manganese(2+);sulfate;heptahydrate Chemical compound O.O.O.O.O.O.O.[Mn+2].[O-]S([O-])(=O)=O OQTQHQORDRKHFW-UHFFFAOYSA-L 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 238000010606 normalization Methods 0.000 description 2
- 239000002853 nucleic acid probe Substances 0.000 description 2
- 239000012074 organic phase Substances 0.000 description 2
- 238000012261 overproduction Methods 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 239000013500 performance material Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 101150068006 phoB gene Proteins 0.000 description 2
- 101150022503 phoR gene Proteins 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 235000009566 rice Nutrition 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 229960000999 sodium citrate dihydrate Drugs 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 235000011008 sodium phosphates Nutrition 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- ZZORFUFYDOWNEF-UHFFFAOYSA-N sulfadimethoxine Chemical compound COC1=NC(OC)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1 ZZORFUFYDOWNEF-UHFFFAOYSA-N 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 230000005026 transcription initiation Effects 0.000 description 2
- 230000001960 triggered effect Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 229910052721 tungsten Inorganic materials 0.000 description 2
- RZLVQBNCHSJZPX-UHFFFAOYSA-L zinc sulfate heptahydrate Chemical compound O.O.O.O.O.O.O.[Zn+2].[O-]S([O-])(=O)=O RZLVQBNCHSJZPX-UHFFFAOYSA-L 0.000 description 2
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- BCOSEZGCLGPUSL-UHFFFAOYSA-N 2,3,3-trichloroprop-2-enoyl chloride Chemical compound ClC(Cl)=C(Cl)C(Cl)=O BCOSEZGCLGPUSL-UHFFFAOYSA-N 0.000 description 1
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108020003589 5' Untranslated Regions Proteins 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 244000198134 Agave sisalana Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000609240 Ambelania acida Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 235000012766 Cannabis sativa ssp. sativa var. sativa Nutrition 0.000 description 1
- 235000012765 Cannabis sativa ssp. sativa var. spontanea Nutrition 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 230000008836 DNA modification Effects 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108091060211 Expressed sequence tag Proteins 0.000 description 1
- 229920001917 Ficoll Polymers 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 241000219146 Gossypium Species 0.000 description 1
- 108010072039 Histidine kinase Proteins 0.000 description 1
- 101000829958 Homo sapiens N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase Proteins 0.000 description 1
- 102000004867 Hydro-Lyases Human genes 0.000 description 1
- 108090001042 Hydro-Lyases Proteins 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical compound C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Natural products CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 125000003798 L-tyrosyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C1=C([H])C([H])=C(O[H])C([H])=C1[H] 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 240000006240 Linum usitatissimum Species 0.000 description 1
- 235000004431 Linum usitatissimum Nutrition 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241000662215 Marinobacter algicola Species 0.000 description 1
- 108020005196 Mitochondrial DNA Proteins 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 102100023315 N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase Human genes 0.000 description 1
- 239000007832 Na2SO4 Substances 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 241001520808 Panicum virgatum Species 0.000 description 1
- 241000364057 Peoria Species 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 241000209504 Poaceae Species 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010034546 Serratia marcescens nuclease Proteins 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 1
- JZRWCGZRTZMZEH-UHFFFAOYSA-N Thiamine Natural products CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N JZRWCGZRTZMZEH-UHFFFAOYSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 108091061763 Triple-stranded DNA Proteins 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical group O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- GZCGUPFRVQAUEE-SLPGGIOYSA-N aldehydo-D-glucose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O GZCGUPFRVQAUEE-SLPGGIOYSA-N 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000035578 autophosphorylation Effects 0.000 description 1
- 230000007940 bacterial gene expression Effects 0.000 description 1
- 239000010905 bagasse Substances 0.000 description 1
- 238000010923 batch production Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 102000006995 beta-Glucosidase Human genes 0.000 description 1
- 108010047754 beta-Glucosidase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960003237 betaine Drugs 0.000 description 1
- 230000008238 biochemical pathway Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 238000011138 biotechnological process Methods 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 235000009120 camo Nutrition 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 239000012876 carrier material Substances 0.000 description 1
- 238000012219 cassette mutagenesis Methods 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 235000005607 chanvre indien Nutrition 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- RPKLZQLYODPWTM-KBMWBBLPSA-N cholanoic acid Chemical compound C1CC2CCCC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@@H](CCC(O)=O)C)[C@@]1(C)CC2 RPKLZQLYODPWTM-KBMWBBLPSA-N 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 239000003636 conditioned culture medium Substances 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 101150105804 cysG gene Proteins 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- DNJIEGIFACGWOD-UHFFFAOYSA-N ethyl mercaptane Natural products CCS DNJIEGIFACGWOD-UHFFFAOYSA-N 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 235000019253 formic acid Nutrition 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000004817 gas chromatography Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000012224 gene deletion Methods 0.000 description 1
- 230000030279 gene silencing Effects 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000012226 gene silencing method Methods 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000011487 hemp Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000001744 histochemical effect Effects 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 150000002431 hydrogen Chemical group 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 239000005457 ice water Substances 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000009776 industrial production Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 229910052816 inorganic phosphate Inorganic materials 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- JDNTWHVOXJZDSN-UHFFFAOYSA-N iodoacetic acid Chemical compound OC(=O)CI JDNTWHVOXJZDSN-UHFFFAOYSA-N 0.000 description 1
- NPFOYSMITVOQOS-UHFFFAOYSA-K iron(III) citrate Chemical compound [Fe+3].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NPFOYSMITVOQOS-UHFFFAOYSA-K 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000009629 microbiological culture Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 230000012666 negative regulation of transcription by glucose Effects 0.000 description 1
- 229940124276 oligodeoxyribonucleotide Drugs 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 101150061261 phoU gene Proteins 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 210000002706 plastid Anatomy 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- RCOUWKSZRXJXLA-UHFFFAOYSA-N propylbarbital Chemical compound CCCC1(CCC)C(=O)NC(=O)NC1=O RCOUWKSZRXJXLA-UHFFFAOYSA-N 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 101150112050 pstB gene Proteins 0.000 description 1
- 101150013628 pstB1 gene Proteins 0.000 description 1
- 101150070239 pstB2 gene Proteins 0.000 description 1
- 101150055035 pstC gene Proteins 0.000 description 1
- 101150033391 pstC1 gene Proteins 0.000 description 1
- 210000004270 pstb Anatomy 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 239000012925 reference material Substances 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000009711 regulatory function Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 239000007320 rich medium Substances 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 150000004671 saturated fatty acids Chemical class 0.000 description 1
- 235000003441 saturated fatty acids Nutrition 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012807 shake-flask culturing Methods 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 229910052938 sodium sulfate Inorganic materials 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 239000010907 stover Substances 0.000 description 1
- 239000010902 straw Substances 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 229920002994 synthetic fiber Polymers 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- KYMBYSLLVAOCFI-UHFFFAOYSA-N thiamine Chemical compound CC1=C(CCO)SCN1CC1=CN=C(C)N=C1N KYMBYSLLVAOCFI-UHFFFAOYSA-N 0.000 description 1
- 235000019157 thiamine Nutrition 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 101150100260 wcaM gene Proteins 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N βâMercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/245—Escherichia (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1051—Hexosyltransferases (2.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
Definitions
- the present invention provides compositions and methods comprising a low-phosphate repressible promoter.
- the present invention provides a low-phosphate repressible promoter from E. coli.
- E. coli Escherichia coli
- E. coli is widely employed as a host cell in protein production systems, as it has a short generation period of about 20 minutes and can utilize a variety of sugars to proliferate.
- plasmid vectors have been developed that are useful in E. coli .
- the rapid and stable industrial production of recombinant proteins has been achieved with host-vector systems employing E. coli as host cell. Nonetheless, there remains a need to better control bacterial gene expression, particularly in commercial process systems.
- the present invention provides compositions and methods comprising a low-phosphate repressible promoter.
- the present invention provides a low-phosphate repressible promoter from E. coli .
- the present invention provides methods for controlling the expression of at least one product of interest through the modulation effects of a low-phosphate repressible promoter as provided herein. Indeed, it is intended that the present invention provide advantages in the selective expression of genes of interest.
- the present invention provides means to silence (i.e., âturn offâ) the expression of certain genes during the growth of a microbial culture, as desired.
- the present invention provides recombinant microorganisms comprising a desired phenotype, wherein the desired phenotype is obtained by exposing the microorganisms to conditions of limited phosphate concentration.
- the genome of the microorganism comprises at least one mutation that alters the phosphate sensitivity of the microorganism.
- the microorganism comprises at least one mutation in pstS.
- the pstS mutation is selected from T10M, T10Y, D56S, and/or T139H.
- the pstS mutations are selected from T10M, T10Y, D56S, and/or T139H, wherein the amino acid positions are numbered with reference to SEQ ID NO:3.
- the recombinant microorganism is present within a culture medium and the desired phenotype is obtained by the expression of at least one gene under the control of at least one heterologous regulatory sequence and the heterologous regulatory sequence responds to the phosphate concentration of the culture medium.
- the microorganism comprises the Pho1 and/or Pho17 promoter.
- the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4.
- the recombinant microorganism comprises the Pho17 sequence set forth in SEQ ID NO:5. In some further embodiments, the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4 and/or the Pho17 sequence set forth in SEQ ID NO:5. In still some additional embodiments, the microorganism is E. coli.
- the present invention also provides methods for producing at least one heterologous polypeptide, comprising culturing a recombinant microorganism comprising at least one polynucleotide sequence encoding at least one heterologous polypeptide in a culture medium comprising a low concentration of phosphate, such that at least one polynucleotide is expressed and at least one heterologous polypeptide is produced.
- at least one heterologous polypeptide is encoded by a heterologous gene wherein the heterologous gene comprises at least one mutation in the regulatory region of the gene.
- the methods further comprise the step of recovering at least one polypeptide.
- the recombinant microorganism comprises at least one mutation in pstS.
- the pstS mutations are selected from T10M, T10Y, D56S, and/or T139H.
- the pstS mutations are selected from T10M, T10Y, D56S, and/or T139H, wherein the amino acid positions are numbered with reference to SEQ ID NO:3.
- the recombinant microorganism comprises the Pho1 and/or Pho17 promoter(s).
- the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4.
- the recombinant microorganism comprises the Pho17 sequence set forth in SEQ ID NO:5. In still some additional embodiments, the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4 and the Pho17 sequence set forth in SEQ ID NO:5. In some embodiments, the microorganism is E. coli . In some additional embodiments, the recombinant microorganism produces an increased yield of at least one heterologous polypeptide, as compared to a recombinant microorganism that does not comprise at least one repressible promoter.
- the recombinant microorganism produces an increased yield of at least one product, as compared to a recombinant microorganism that does not comprise a repressible promoter.
- the product comprises at least one alcohol.
- at least one heterologous polypeptide is selected from eukaryotic and prokaryotic polypeptides.
- the present invention also provides a low-phosphate repressible promoter comprising Pho1.
- the Pho1 promoter comprises SEQ ID NO:4.
- the present invention further provides a low-phosphate repressible promoter comprising Pho17.
- the Pho17 promoter comprises SEQ ID NO:5.
- the present invention further provides expression constructs comprising at least one low-phosphate repressible promoter.
- the expression constructs comprise the Pho1 promoter and/or Pho17 promoter.
- the Pho1 promoter comprises SEQ ID NO:4.
- the Pho17 promoter comprises SEQ ID NO:5.
- the present invention also provides recombinant host cells comprising at least one low-phosphate repressible promoter, wherein the promoter is the low-phosphate repressible promoter Pho1 and/or Pho17.
- the Pho1 promoter comprises SEQ ID NO:4.
- the Pho17 promoter comprises SEQ ID NO:5.
- the host cell exhibits a desired phenotype.
- FIG. 1 provides partial DNA sequence of promoters Pho1 (SEQ ID NO:4) and Pho17 (SEQ ID NO:5).
- the arrows indicate the position and orientation of the Pho boxes according to Diniz et al. (Diniz et al., J. Bact. 193: 6929-6938 [2011]).
- the base changed in Pho17 is shown in italics.
- the â 35 and â 10 regions of the promoter are also indicated.
- FIG. 2 provides a schematic showing the construction of a kanamycin-Pho1 promoter cassette as described in Example 2.
- a transcriptional promoter (herein referred as a âpromoterâ), is the region of the chromosome where the RNA polymerase binds, in order to initiate DNA transcription, thereby producing RNA capable of performing a biological function. Promoter activity is controlled by activation and/or repression mechanisms that enhance or decrease the promoter's capacity to drive RNA production. In most biotechnological processes utilizing E. coli as the production host, strong promoters are routinely used. These promoters are typically controlled by the binding of a repressor which inhibits the productive interaction of RNA polymerase with the promoter.
- the most widely used promoter system in E. coli and other bacteria is the Lac promoter (Plac) and its repressor LacI. This system is commonly induced in the laboratory by the addition of the gratuitous inducer, isopropyl-beta-D-thio-galactosidase (IPTG).
- Another common expression system in E. coli is derived from the PhoA and PstS promoters, which are activated by the PhoB protein only when the level of phosphate (Pi) in the growth media is low.
- phosphate as a way to modulate gene expression is particularly useful because phosphate is normally added to most growth media, and its levels can be easily controlled.
- assimilation of phosphorus-containing compounds depends on the extracellular Pi concentration and is based on a sensing mechanism controlled by a two-component regulatory system.
- the system is encoded by the phoB and phoR genes.
- PhoR is a sensor histidine kinase that monitors the extracellular availability of phosphate
- PhoB is the response regulator that controls gene expression.
- the E. coli response to low-phosphate conditions involves PhoR autophosphorylation and the transfer of Pi to PhoB.
- Phosphorylated PhoB(PhoB â Pi) binds with higher affinity than non-phosphorylated PhoB to DNA and exerts its regulatory function on gene expression.
- PhoB â Pi activates the expression of a more than 40 genes (i.e., the Pho regulon) by binding to conserved 18-bp DNA sequences referred to as âPho boxesâ located upstream of the promoters of the Pho regulon genes (See e.g., Hasieh and Wanner. Curr. Opin. Microbiol., 13:198-203 [2010]).
- Pho boxes located upstream of the promoters of the Pho regulon genes
- coli consensus Pho box CT(G or T)TCAT A(A or T)A (A or T) CTGTCA(T OR C) consist of two 7-bp directed repeats separated by a conserved 4-bp AT rich spacer (See, Blanco et al., Structure 10:701-713 [2002]; and Diniz et al., J. Bact., 193:6929-6938 [2011]).
- the use of a low-phosphate repressible promoter is useful when gene(s) need to be turned off (e.g., because their product is not needed) and/or the presence of the gene product interferes with the over-production of a desired product.
- the present invention provides new promoter systems for E. coli that can be repressed by low phosphate conditions.
- the phosphate sensor mechanism of a host cell is modified.
- mutations in the phosphate-binding pocket of the PstS sensor of E. coli can affect its affinity for phosphate and as a consequence, the sensitivity of the sensor mechanism (See e.g., U.S. Pat. No. 5,304,472; Yao et al., Biochem., 35:2079-2085 [1996]. Any suitable method for introducing mutations in the endogenous E.
- coli pstS gene find use in the present invention, including but not limited to oligonucleotide site-directed mutagenesis using the lambda RED recombineering technology as described herein.
- mutations in one or more genes involved in the inorganic phosphate sensing mechanism e.g., phoB, phoR, phoU pstsA, pstB, pstC, and/or pstS
- the host strain is E. coli . Indeed, it is intended that the present invention find use in the production of any suitable heterologous polypeptide(s) by bacteria comprising at least one phosphate-repressible promoter of the present invention.
- phosphate depletion refers to a marked decrease in phosphate in the media, as compared to the phosphate concentration routinely used in culture media.
- the PhoB-PhoR system is induced when the phosphate concentration is below about 50 micromolar (See e.g., Lubke et al., Enz. Microb. Technol., 17:923-928 [1995]).
- phosphate-binding region is the region of a protein that binds to phosphate.
- the E. coli âPstS proteinâ refers to the protein encoded by the âPstS geneâ in bacterial cells, including but not limited to the Enterobacteriaceae (e.g., E. coli ).
- the E. coli PstS comprises the following polypeptide and polynucleotide sequences, respectively:
- enzyme variant and âvariant enzyme,â including âPstS variantâ are used in reference to enzymes that are similar to a reference enzyme, particularly in their function, but have mutations in their amino acid sequence that make them different in sequence from the wild-type or another reference enzyme.
- Enzyme variants can be made by a wide variety of different mutagenesis techniques well known to those skilled in the art.
- mutagenesis kits are also available from many commercial molecular biology suppliers. Methods are available to make specific substitutions at defined amino acids (site-directed), specific or random mutations in a localized region of the gene (regio-specific) or random mutagenesis over the entire gene (e.g., saturation mutagenesis).
- enzyme variants including but not limited to site-directed mutagenesis of single-stranded DNA or double-stranded DNA using PCR, cassette mutagenesis, gene synthesis, error-prone PCR, shuffling, and chemical saturation mutagenesis, or any other suitable method known in the art. After the variants are produced, they can be screened for any suitable desired property.
- promoter refers to transcriptional promoters (i.e., sequences that direct the transcription of polynucleotides).
- a âpromoter sequenceâ is a nucleic acid sequence that is recognized by a host cell for expression of the coding region.
- the control sequence may comprise an appropriate promoter sequence.
- the promoter sequence contains transcriptional control sequences that mediate the expression of the polypeptide.
- the promoter may be any nucleic acid sequence which shows transcriptional activity in the host cell of choice including mutant, truncated, and hybrid promoters, and may be obtained from genes encoding extracellular or intracellular polypeptides either endogenous or heterologous to the host cell.
- bacterial promoter refers to a promoter that is capable of initiating transcription in bacterial cells. In some embodiments, the promoter is capable of modulating the transcription of at least one polynucleotide. In some embodiments, the bacterial promoter is an E. coli promoter.
- a ârepressible promoterâ is a promoter that exhibits a reduced capacity to function under certain conditions.
- phosphate-regulated promoter is a transcriptional promoter, wherein the promoter's capacity to function is regulated by the phosphate level in the growth media used to culture the cells in which the promoter resides.
- phosphate sensitivity refers to the effects of phosphate in media on a phosphate-regulated promoter.
- the promoters are relatively insensitive to the phosphate concentration (i.e., the phosphate concentration has no impact on the activity of the promoter), while in some other embodiments, the promoters are very sensitive to the phosphate concentration (i.e., the phosphate concentration greatly influences the activity of the promoter).
- a âlow-phosphate-repressible promoter,â is a transcriptional promoter, wherein the promoter's capacity to function is reduced under low-phosphate conditions, as compared to the promoter's functional capacity under conditions in which the phosphate in the growth medium used to culture the bacteria comprising the promoter is in high concentration, such as in growth media that are commonly used to culture bacteria.
- low-phosphate conditions refer to a phosphate concentration in growth media lower than about 50 micromolar.
- inducible promoter refers to a transcriptional promoter, wherein the promoter's capacity to function efficiently, requires the presence or absence of chemical or physical factors.
- the inducible promoter's activity is influenced by certain conditions (e.g., light, temperature, chemical concentration, protein concentration, etc.).
- the term âconstitutive promoterâ refers to promoters that actively promote transcription under most, but not necessarily all environmental conditions and/or states of cell development and/or differentiation.
- optional promoter fragments refer to any sub-sequence(s) of a promoter that is/are not required for driving transcription of an operably linked coding region.
- these fragments comprise the 5â² UTR (i.e., 5â² untranslated region), as well as any exon(s) of the endogenous coding region.
- optional promoter fragments comprise any exon(s) and the 3â² or 5â² of the gene residing upstream of the promoter (i.e., 5â² to the promoter).
- the term also encompasses any intervening sequences (i.e., introns), as well as sequence that occurs between exons or an exon and the UTR.
- preferential transcription refers to transcription that occurs in response to specific stimuli (e.g., low or high phosphate concentrations). Preferential transcription can be assessed by measuring initiation, rate, and/or transcription levels.
- modulate transcription refers to the activity of a promoter sequence to affect up- and down-regulation of transcription initiation, rate of transcription, and/or transcription levels, as well as any other relevant biological activity.
- transcription start site refers to the point at which transcription is initiated on a polynucleotide.
- phenotype refers to the observable characteristics of a strain. These characteristics result from the expression of the strain's genes, as well as the influence of environmental factors and the interactions between the two. Examples of phenotypes include but are not limited to the growth rate of a strain under a particular set of conditions; the ability of a strain to use glucose as a carbon source; and/or the capability of a strain to express certain gene(s) under low-phosphate growth conditions.
- a âdesired phenotypeâ is a particular phenotype that is obtained by at least one genetic modification of a strain.
- the desired phenotype is different from the strain's phenotype prior to the genetic modification(s).
- the starting (i.e., parent) strain is capable of expressing certain genes under low phosphate conditions and the desired phenotype is a strain unable to express such genes under the same growth conditions.
- the parent strain is capable of expressing certain genes under high phosphate conditions and the desired phenotype is a strain unable to express such genes under the same growth conditions.
- pathway refers to a set of system components that are involved in at least two sequential interactions that result in the production of a product and/or activity.
- the term encompasses various pathway types, including but not limited to biochemical pathways, gene expression pathways, regulatory pathways, and/or a combination of these exemplary pathway types.
- public sequence refers to any sequence deposited in a publicly accessible database.
- the term encompasses amino acid and nucleotide sequences.
- publicly available databases include, but are not limited to the NCBI FTP website, GenBank, European Bioinformatics Institute (EBI-EMBL), DNA Database of Japan (DBBJ), and Brookhaven Protein Data Bank (PDB), as well as the databases associated with patent offices (e.g., the US Patent & Trademark Office).
- polynucleotide and ânucleic acidâ, used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. These terms include, but are not limited to, single-, double- or triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, polymers comprising purine and pyrimidine bases, and/or other natural, chemically, biochemically modified, non-natural or derivatized nucleotide bases.
- polynucleotides genes, gene fragments, chromosomal fragments, ESTs, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- polynucleotides comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracyl, other sugars and linking groups such as fluororibose and thioate, and/or nucleotide branches.
- the sequence of nucleotides is interrupted by non-nucleotide components.
- DNA construct and âtransforming DNAâ are used interchangeably to refer to DNA that is used to introduce sequences into a host cell or organism.
- the DNA may be generated in vitro by PCR or any other suitable technique(s) known to those in the art.
- the DNA construct comprises a sequence of interest (e.g., as an âincoming sequenceâ).
- the sequence is operably linked to additional elements such as control elements (e.g., promoters, etc.).
- the DNA construct further comprises at least one selectable marker.
- the DNA construct comprises an incoming sequence flanked by homology boxes.
- the transforming DNA comprises other non-homologous sequences, added to the ends (e.g., stuffer sequences or flanks).
- the ends of the incoming sequence are closed such that the transforming DNA forms a closed circle.
- the transforming sequences may be wild-type, mutant or modified.
- the DNA construct comprises sequences homologous to the host cell chromosome. In some other embodiments, the DNA construct comprises non-homologous sequences.
- the DNA construct may be used to: 1) insert heterologous sequences into a desired target sequence of a host cell; 2) mutagenize a region of the host cell chromosome (i.e., replace an endogenous sequence with a heterologous sequence); 3) delete target genes; and/or 4) introduce a replicating plasmid into the host.
- the incoming sequence comprises at least one selectable marker. This sequence can code for one or more proteins of interest. It can have other biological functions. In many cases the incoming sequence comprises at least one selectable marker, such as a gene that confers antimicrobial resistance.
- expression cassette and âexpression vectorâ refer to nucleic acid constructs generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
- the recombinant expression cassette/vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- expression vectors have the ability to incorporate and express heterologous DNA fragments in a host cell. Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those of skill in the art.
- expression cassette is used interchangeably herein with âDNA construct,â and their grammatical equivalents. Selection of appropriate expression vectors is within the knowledge of those of skill in the art.
- the term âvectorâ refers to a polynucleotide construct designed to introduce nucleic acids into one or more cell types.
- Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, cassettes and the like.
- the polynucleotide construct comprises a DNA sequence encoding the enzyme (e.g., precursor or mature enzyme) that is operably linked to a suitable prosequence capable of effecting the expression of the DNA in a suitable host.
- a secretion signal peptide can be a propeptide, a prepeptide or both.
- propeptide refers to a protein precursor that is cleaved to yield a mature protein.
- prepeptide refers to a polypeptide synthesized with an N-terminal signal peptide that targets it for secretion.
- pre-pro-peptide is a polypeptide that contains a signal peptide that targets the polypeptide for secretion and which is cleaved off to yield a mature polypeptide.
- Signal peptides are found at the N-terminus of the protein and are typically composed of between about 3 to about 136 basic and hydrophobic amino acids.
- plasmid refers to a circular double-stranded (ds) DNA construct used as a cloning vector, and which forms an extrachromosomal self-replicating genetic element in some eukaryotes or prokaryotes, or integrates into the host chromosome.
- the term âintroducedâ refers to any method suitable for transferring the nucleic acid sequence into the cell. Such methods for introduction include but are not limited to protoplast fusion, transfection, transformation, conjugation, transduction, and electroporation.
- the terms âtransformedâ and âstably transformedâ refers to a cell that has a non-native (i.e., heterologous) polynucleotide sequence integrated into its genome or as an episomal plasmid that is maintained for at least two generations.
- control sequences and âregulatory sequencesâ refer to nucleic acid sequences necessary and/or useful for expression of a polynucleotide encoding a polypeptide.
- control sequences are native (i.e., from the same gene) or foreign (i.e., from a different gene) to the polynucleotide encoding the polypeptide.
- Control sequences include, but are not limited to leaders, polyadenylation sequences, propeptide sequences, promoters, signal peptide sequences, and transcription terminators.
- at a minimum, control sequences include a promoter, and transcriptional and translational stop signals.
- control sequences are provided with linkers for the purpose of introducing specific restriction sites facilitating ligation of the control sequences with the coding region of the polynucleotide encoding the polypeptide.
- operably linked refers to a configuration in which a control sequence is appropriately placed (i.e., in a functional relationship) at a position relative to a polynucleotide of interest such that the control sequence directs or regulates the expression of the polynucleotide and/or polypeptide of interest.
- a nucleic acid is âoperably linkedâ to another nucleic acid sequence when it is placed into a functional relationship with another nucleic acid sequence.
- DNA encoding a secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- âoperably linkedâ means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- âInactiveâ or âinactivatedâ in reference to a gene refers to a gene having at least one function that is impaired. Genes can be inactivated in a variety of ways known in the art, including but not limited to insertion of a mobile genetic element (e.g., a transposon); deletion of all or part of the gene, such that the gene product is not made, or is truncated and is non-functional; mutation of the gene such that the gene product is not made, or is truncated and is non-functional; deletion or mutation of one or more control elements that control expression of the gene such that the gene product is not made; and the like. In certain embodiments genes can be inactivated by methods other than genetic modification, for example, by gene silencing at the transcriptional level or at the post-transcriptional level using for example RNAi.
- a mobile genetic element e.g., a transposon
- deletion of all or part of the gene such that the gene product is not made, or is truncated and is non-functional
- Recombinant host cell refers to a cell into which has been introduced a heterologous polynucleotide, gene, promoter, e.g., an expression vector, or to a cell having a heterologous polynucleotide or gene integrated into the genome.
- Naturally-occurring or wild-type refers to the form found in nature.
- a naturally occurring or wild-type polypeptide or polynucleotide sequence is a sequence present in an organism that can be isolated from a source in nature and which has not been intentionally modified by human manipulation.
- a wild-type organism refers to an organism that has not been intentionally modified by human manipulation.
- transformed or âtransformationâ used in reference to a cell means a cell has a non-native nucleic acid sequence integrated into its genome or as a plasmid that is maintained through multiple generations.
- gene refers to a polynucleotide (e.g., a DNA segment), that encodes a polypeptide and includes regions preceding and following the coding regions as well as intervening sequences (introns) between individual coding segments (exons).
- the carrier material is finally washed three times each for 15 minutes using 2 â SSC, 0.2% SDS at least at 50° C. (âlowâ stringency), at least at 55° C. (âmediumâ or âmoderateâ stringency), at least at 60° C. (âmedium-highâ stringency), at least at 65° C. (âhighâ stringency), and at least at 70° C. (âvery highâ stringency).
- the stringency conditions include those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ a denaturing agent during hybridization, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5 â SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5 â Denhardt's solution, sonicated salmon sperm DNA (50 â g/mL), 0.1% SDS, and 10% dextran sulfate at 42° C., with washe
- the stringency conditions include overnight incubation at 37° C. in a solution comprising: 20% formamide, 5 â SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5 â Denhardt's solution, 10% dextran sulfate, and 20 mg/mL denatured sheared salmon sperm DNA, followed by washing the filters in 1 â SSC at about 37-50° C.
- 5 â SSC 150 mM NaCl, 15 mM trisodium citrate
- 50 mM sodium phosphate pH 7.6
- 5 â Denhardt's solution 10% dextran sulfate
- 20 mg/mL denatured sheared salmon sperm DNA followed by washing the filters in 1 â SSC at about 37-50° C.
- the skilled artisan will recognize how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors to accomplish the desired stringency.
- an âendogenousâ or âhomologousâ gene refers to a gene that is found in a parental strain of a cell (e.g., a bacterial cell). In some embodiments, endogenous genes are present in wild-type strains.
- âhomologous genesâ refers to genes from different, but usually related species, that correspond to each other and are identical or very similar to each other. The term encompasses genes that are separated by speciation (i.e., the development of new species) (e.g., orthologous genes), as well as genes that have been separated by genetic duplication (e.g., paralogous genes).
- heterologous polynucleotides are any polynucleotides that are introduced into a host cell through the use of laboratory techniques/manipulation, and include polynucleotides that are removed from a host cell, subjected to laboratory manipulation, and then reintroduced into a host cell.
- heterologous refers to a sequence that is not normally expressed and secreted by an organism (e.g., a âwild-typeâ organism).
- the term encompasses a sequence that comprises two or more subsequences which are not found in the same relationship to each other as normally found in nature, or is recombinantly engineered so that its level of expression, or physical relationship to other nucleic acids or other molecules in a cell, or structure, is not normally found in nature.
- a heterologous nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged in a manner not found in nature (e.g., a nucleic acid open reading frame (ORF) of the invention operatively linked to a promoter sequence inserted into an expression cassette, such as a vector).
- ORF nucleic acid open reading frame
- heterologous enzyme is used in reference to an enzyme that is encoded by a heterologous gene.
- a heterologous gene can encode an endogenous or homologous enzyme.
- the term âheterologous geneâ refers to a gene that occurs in a form not found in a parental strain of the cell.
- a heterologous gene is a gene that is derived from a species that is different from the species of the cell expressing the gene and recognized anamorphs, teleomorphs or taxonomic equivalents of the cell expressing the gene.
- a heterologous gene is a modified version of a gene that is endogenous to the host cell (e.g., an endogenous gene subjected to manipulation and then introduced or transformed into the host cell).
- a heterologous gene has an endogenous coding sequence, but has modifications in the promoter sequence.
- a heterologous gene encodes the same amino acid sequence as an endogenous gene, but has modifications in codon usage and/or to noncoding regions (e.g., introns), and/or combinations thereof.
- a heterologous gene contains modifications to the coding sequence to encode a non-wild-type polypeptide.
- a heterologous gene has the same promoter sequence, 5â² and 3â² untranslated regions and coding regions as a parental strain, but is located in another region of the same chromosome, or on an entirely different chromosome as compared to a parental strain of the host cell.
- the heterologous gene is a gene that has been modified to overexpress a gene product of interest.
- recombinant includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid sequence or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found in identical form within the native (i.e., non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under-expressed or not expressed at all as a result of deliberate human intervention.
- Recombinant âengineered.â and ânon-naturally occurring,â when used with reference to a cell, nucleic acid, or polypeptide, refers to a material, or a material corresponding to the natural or native form of the material, that has been modified in a manner that would not otherwise exist in nature, or is identical thereto but produced or derived from synthetic materials and/or by manipulation using recombinant techniques.
- Non-limiting examples include, among others, recombinant cells expressing genes that are not found within the native (i.e., non-recombinant) form of the cell or express native genes that are otherwise expressed at a different level.
- âRecombination,â ârecombining,â and âgenerating a recombinedâ nucleic acid also encompass the assembly of two or more nucleic acid fragments wherein the assembly gives rise to a chimeric gene.
- a âgenetically modifiedâ or âgenetically engineeredâ cell is a cell whose genetic material has been altered using genetic engineering techniques.
- a genetically modified cell also refers to a derivative of or the progeny of a cell whose genetic material has been altered using genetic engineering techniques.
- An example of a genetic modification as a result of genetic engineering techniques includes a modification to the genomic DNA.
- Another example of a genetic modification as a result of genetic engineering techniques includes introduction of a stable heterologous nucleic acid into the cell.
- expression refers to the any step involved in the production of at least one polypeptide of interest, including but not limited to transcription and translation.
- overexpression refers to any state in which a gene is caused to be expressed at an elevated rate or level as compared to the endogenous expression rate or level for that gene.
- âoverexpressionâ includes an elevated translation rate or level of the gene compared to the endogenous translation rate or level for that gene.
- overexpression includes an elevated transcription rate or level of the gene compared to the endogenous transcription rate or level for that gene.
- a heterologous gene is introduced into a cell to express a gene encoding a heterologous protein enzyme (e.g., beta-glucosidase or any other suitable enzyme or protein of interest) from another organism.
- a heterologous gene is introduced into a cell to overexpress a gene encoding a homologous enzyme such as a fatty alcohol reductase.
- amplification and âgene amplificationâ refer to a method by which specific DNA sequences are disproportionately replicated such that the amplified gene becomes present in a higher copy number than was initially present in the genome.
- selection of cells by growth in the presence of a drug results in the amplification of either the endogenous gene encoding the gene product required for growth in the presence of the drug or by amplification of exogenous (i.e., input) sequences encoding this gene product, or both.
- a drug e.g., an inhibitor of an inhibitable enzyme
- Template specificity is here distinguished from fidelity of replication (i.e., synthesis of the proper polynucleotide sequence) and nucleotide (ribo- or deoxyribo-) specificity. Template specificity is frequently described in terms of âtargetâ specificity. Target sequences are âtargetsâ in the sense that they are sought to be sorted out from other nucleic acid. Amplification techniques have been designed primarily for this sorting out.
- the term âprimerâ refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, that is capable of acting as a synthesis initiation point when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH).
- the primer is preferably single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products.
- the primer is an oligodeoxyribonucleotide.
- the primer must be sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. As known in the art, the exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.
- probe refers to an oligonucleotide (i.e., a sequence of nucleotides), whether occurring naturally as in a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, that is capable of hybridizing to another oligonucleotide of interest.
- a probe may be single-stranded or double-stranded. Probes are useful in the detection, identification and isolation of particular gene sequences.
- any probe used in the present invention will be labeled with any âreporter molecule,â so that is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA, as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. It is not intended that the present invention be limited to any particular detection system or label.
- target when used in reference to the polymerase chain reaction, refers to the region of nucleic acid bounded by the primers used for polymerase chain reaction. Thus, the âtargetâ is sought to be sorted out from other nucleic acid sequences.
- a âsegmentâ is defined as a region of nucleic acid within the target sequence.
- PCR polymerase chain reaction
- amplification reagents refers to those reagents (deoxyribonucleotide triphosphates, buffer, etc.), needed for amplification except for primers, nucleic acid template and the amplification enzyme.
- amplification reagents along with other reaction components are placed and contained in a reaction vessel (test tube, microwell, etc.).
- restriction endonucleases and ârestriction enzymesâ refer to bacterial enzymes, each of which cut double-stranded DNA at or near a specific nucleotide sequence.
- restriction site refers to a nucleotide sequence recognized and cleaved by a given restriction endonuclease and is frequently the site for insertion of DNA fragments.
- restriction sites are engineered into the selective marker and into 5â² and 3â² ends of the DNA construct.
- homologous recombination means the exchange of DNA fragments between two DNA molecules or paired chromosomes at the site of identical or nearly identical nucleotide sequences.
- chromosomal integration is homologous recombination.
- amino acid refers to peptide or protein sequences or portions thereof.
- protein protein
- peptide polypeptide
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified (e.g., hydroxyproline, â -carboxyglutamate, and O-phosphoserine).
- amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid (i.e., an â -carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as homoserine, norleucine, methionine sulfoxide, or methionine methyl sulfonium). Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
- Nucleotides likewise, may be referred to by their commonly accepted single-letter codes. It is also understood that a polypeptide may be encoded by more than one nucleotide sequence, due to the degeneracy of the genetic code.
- an amino acid or nucleotide base âpositionâ is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5â²-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion.
- the terms ânumbered with reference toâ or âcorresponding to,â when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.
- âconservative substitution,â as used with respect to amino acids, refers to the substitution of an amino acid with a chemically similar amino acid. Amino acid substitutions that do not generally alter specific activity are well known in the art and are described in numerous textbooks.
- a conservative substitute for a residue is another residue in the same group as shown in the Table below.
- âconservativeâ amino acid substitutions or mutations refer to the interchangeability of residues having similar side chains, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids.
- conservative mutations do not include substitutions from a hydrophilic to hydrophilic, hydrophobic to hydrophobic, hydroxyl-containing to hydroxyl-containing, or small to small residue, if the conservative mutation can instead be a substitution from an aliphatic to an aliphatic, non-polar to non-polar, polar to polar, acidic to acidic, basic to basic, aromatic to aromatic, or constrained to constrained residue.
- A, V, L, or I can be conservatively mutated to either another aliphatic residue or to another non-polar residue. The following table provides exemplary conservative substitutions.
- Non-conservative substitution refers to substitution or mutation of an amino acid in the polypeptide with an amino acid with significantly differing side chain properties. Non-conservative substitutions may use amino acids between, rather than within, the defined groups listed above. In one embodiment, a non-conservative mutation affects (a) the structure of the peptide backbone in the area of the substitution (e.g., proline for glycine) (b) the charge or hydrophobicity, or (c) the bulk of the side chain.
- substitution e.g., proline for glycine
- substitutions in a reference sequence relative to a reference sequence or a variant polypeptide or nucleic acid sequence âR-#-V,â where â#â refers to the position in the reference sequence, âRâ refers to the amino acid (or base) at that position in the reference sequence, and âVâ refers to the amino acid (or base) at that position in the variant sequence.
- amino acid substitution set or âsubstitution setâ refers to a group of amino acid substitutions.
- a substitution set can have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more amino acid substitutions.
- deletion when used in reference to a polypeptide, refers to modification of the polypeptide by removal of one or more amino acids from a reference polypeptide.
- Deletions can comprise removal of 1 or more amino acids, 2 or more amino acids, 3 or more amino acids, 4 or more amino acids, 5 or more amino acids, 6 or more amino acids, 7 or more amino acids, 8 or more amino acids, 9 or more amino acids, 10 or more amino acids, 15 or more amino acids, or 20 or more amino acids, up to 10% of the total number of amino acids, or up to 20% of the total number of amino acids making up the polypeptide while retaining enzymatic activity and/or retaining the improved properties of an engineered at least one protease enzyme.
- Deletions may be present in the internal portions and/or terminal portions of the polypeptide. In some embodiments, the deletion comprises a continuous segment, while in other embodiments, it is discontinuous.
- a âgene deletionâ or âdeletion mutationâ is a mutation in which at least part of a sequence of the DNA making up the gene is missing.
- a âdeletionâ in reference to nucleic acids is a loss or replacement of genetic material resulting in a complete or partial disruption of the sequence of the DNA making up the gene, including its regulatory sequences involved in DNA transcription and RNA translation. Any number of nucleotides can be deleted, from a single base to an entire piece of a chromosome.
- the term âdeletionâ refers to the removal of a gene necessary for encoding a specific protein (e.g., a protease). In this case, the strain having this deletion can be referred to as a âdeletion strain.â
- Insertions refers to modification to the polypeptide by addition of one or more amino acids to the reference polypeptide.
- the modification comprises insertions of one or more amino acids to the naturally occurring polypeptide as well as insertions of one or more amino acids to other modified polypeptides.
- Insertions can be in the internal portions of the polypeptide, or to the carboxy or amino terminus. Insertions as used herein include fusion proteins as is known in the art. The insertion can be a contiguous segment of amino acids or separated by one or more of the amino acids in the naturally occurring polypeptide.
- the term âinsertionâ is also used to refer to a DNA modification in which or more nucleotides or nucleotide base-pairs have been inserted, as compared to the corresponding reference, parental or âwild typeâ DNA.
- the phrases âdifferent fromâ and âdiffers fromâ when used with respect to a designated reference sequence refers to difference of a given amino acid or polynucleotide sequence when aligned to the reference sequence. Generally, the differences can be determined when the two sequences are optimally aligned. Differences include insertions, deletions, or substitutions of amino acid residues in comparison to the reference sequence.
- the phrase âderived fromâ a particular organism refers to a wild-type polynucleotide or polypeptide that originates in the organism and to mutant and variants thereof that either originate in the organism or are produced by human manipulation of the wild-type polynucleotide or polypeptide.
- âFunctional fragmentâ as used herein refers to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion, but where the remaining amino acid sequence is identical to the corresponding positions in the sequence and that retains substantially all of the activity of the full-length polypeptide.
- Functional fragments can comprise up to about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% of the full-length polypeptide.
- Percentage of sequence identity âPercent identityâ and âpercentage homologyâ are used interchangeably herein to refer to comparisons among polynucleotides and polypeptides, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which may also contain gaps to optimize the alignment) for alignment of the two sequences.
- the percentage may be calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (including positions where one of the sequences has a gap) and multiplying the result by 100 to yield the percentage of sequence identity.
- the percentage may be calculated by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
- Alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (See, Smith and Waterman, Adv. Appl. Math., 2:482 [1981]), by the homology alignment algorithm of Needleman and Wunsch, (See, Needleman and Wunsch, J. Mol. Biol., 48:443 [1970]), by the search for similarity method of Pearson and Lipman (See, Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 [1988]), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the GCG Wisconsin Software Package), or by visual inspection, using methods known in the art.
- the Clustal See, Chenna et al., Nucl. Acids Res., 31:3497-3500 [2003]
- T-Coffee See, Notredame et al., J. Mol. Biol., 302:205-217 [2000]
- BLAST and BLAST 2.0 algorithms See e.g., Altschul et al., J. Mol. Biol., 215:403-410 [1990]; and Altschul et al., Nucl. Acids Res., 25:3389-3402 [1977], respectively).
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence.
- HSPs high scoring sequence pairs
- T is referred to as, the neighborhood word score threshold (See, Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues: always >0) and N (penalty score for mismatching residues; always â 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
- Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value: the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments: or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (See, Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 [1989]).
- W wordlength
- E expectation
- BLOSUM62 scoring matrix See, Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 [1989].
- Exemplary determination of sequence alignment and % sequence identity can employ the BESTFIT or GAP programs in the GCG Wisconsin Software package (Accelrys, Madison Wis.), using default parameters provided.
- Reference sequence refers to a defined sequence used as a basis for a sequence comparison.
- a reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or polypeptide sequence.
- a reference sequence is at least 20 nucleotide or amino acid residues in length, at least 25 residues in length, at least 50 residues in length, or the full length of the nucleic acid or polypeptide.
- two polynucleotides or polypeptides may each (1) comprise a sequence (i.e., a portion of the complete sequence) that is similar between the two sequences, and (2) may further comprise a sequence that is divergent between the two sequences, sequence comparisons between two (or more) polynucleotides or polypeptide are typically performed by comparing sequences of the two polynucleotides over a âcomparison windowâ to identify and compare local regions of sequence similarity.
- Comparison window refers to a conceptual segment of at least about 20 contiguous nucleotide positions or amino acids residues wherein a sequence may be compared to a reference sequence of at least 20 contiguous nucleotides or amino acids and wherein the portion of the sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- the comparison window can be longer than 20 contiguous residues, and includes, optionally 30, 40, 50, 100, or longer windows.
- substrate refers to a substance or compound that is converted or designated for conversion into another compound (e.g., a product) by the action of an enzyme.
- the term includes not only a single compound but also combinations of compounds, such as solutions, mixtures and other materials which contain at least one substrate.
- conversion refers to the enzymatic transformation of a substrate to the corresponding product.
- Percent conversion refers to the percent of the substrate that is converted to the product within a period of time under specified conditions.
- the âenzymatic activityâ or âactivityâ of a polypeptide can be expressed as âpercent conversionâ of the substrate to the product.
- culturing and âcultivationâ refer to growing a population of microbial cells under suitable conditions in a liquid, solid or semi-solid medium. In some embodiments, culturing refers to the fermentative bioconversion of a substrate to an end-product. Culturing media are well known and individual components of such culture media are available from various commercial sources (e.g., Difco® and BBL® media).
- the aqueous nutrient medium is a ârich mediumâ comprising complex sources of nitrogen, salts, and carbo, such as YP medium, comprising 10 g/L of peptone and 10 g/L yeast extract of such a medium.
- cells are grown under batch or continuous fermentations conditions.
- Continuous culturing is an open system in which a culture medium (typically, a defined culture medium) is added continuously to a bioreactor and an equal amount of conditioned medium is removed simultaneously for processing. Continuous culturing generally maintains the cultures at a constant high density where cells are primarily in log phase growth. Continuous culturing systems strive to maintain steady state growth conditions. Methods for modulating nutrients and growth factors for continuous culturing processes as well as techniques for maximizing the rate of product formation are well known in the art of industrial microbiology.
- ârepeated fed-batchâ culturing finds use in the present invention.
- the feed i.e., comprising at least one carbon source
- the broth volume reaches a predefined working volume of the culture vessel, a portion of the broth is removed, generating new vessel capacity to accommodate further carbon source feeding.
- the repeated fed-batch systems are useful to maximize culture vessel capacity and enable the production of more total product than the standard fed-batch process.
- fed-batch method refers to a method by which a fed-batch culture or repeated fed-batch culture is supplied with additional nutrients.
- fed-batch methods comprise adding supplemental media according to a determined feeding schedule within a given time period.
- fermentations are carried out a temperature within the range of from about 10° C. to about 60° C., from about 15° C. to about 50° C., from about 20° C. to about 45° C., and from about 25° C. to about 40° C.
- the fermentation is carried out at a temperature of from about 28° C. and also from about 30° C.
- the fermentation is carried out for a period of time within the range of from about 8 hours to 240 hours, from about 8 hours to about 168 hours, from about 16 hours to about 144 hours, from about 16 hours to about 120 hours, or from about 24 hours to about 72 hours.
- thermostable host cells may be used.
- fermentations may be carried out at higher temperatures.
- the fermentation will be carried out at a pH in the range of 4 to 8, in the range of 4.5 to 7.5, in the range of 5 to 7, and also in the range of 5.5 to 6.5.
- Carbon sources useful in the aqueous fermentation medium or broth of the disclosed process in which the recombinant microorganisms are grown are those assimilable by the recombinant host strain.
- Assimilable carbon sources are available in many forms and include renewable carbon sources and the cellulosic and starch feedstock substrates obtained there from. Such examples include for example monosaccharides, disaccharides, oligosaccharides, saturated and unsaturated fatty acids, succinate, acetate and mixtures thereof.
- Further carbon sources include, without limitation, glucose, galactose, sucrose, xylose, fructose, glycerol, arabinose, mannose, raffinose, lactose, maltose, and mixtures thereof.
- the term âfermentable sugarsâ is used interchangeably with the term âassimilable carbon source.â
- fermentation is carried out with a mixture of glucose and galactose as the assimilable carbon source.
- fermentation is carried out with glucose alone to accumulate biomass, after which the glucose is substantially removed and replaced with an inducer (e.g., galactose for induction of expression of one or more heterologous genes involved in fatty alcohol production).
- an inducer e.g., galactose for induction of expression of one or more heterologous genes involved in fatty alcohol production.
- fermentation is carried out with an assimilable carbon source that does not mediate glucose repression (e.g., raffinose), to accumulate biomass, after which the inducer (e.g., galactose), is added to induce expression of one or more heterologous genes involved in fatty alcohol production.
- an assimilable carbon source that does not mediate glucose repression (e.g., raffinose)
- the inducer e.g., galactose
- the assimilable carbon source is from cellulosic and starch feedstock derived from but not limited to, wood, wood pulp, paper pulp, grain, corn stover, corn fiber, rice, paper and pulp processing waste, woody or herbaceous plants, fruit or vegetable pulp, distillers grain, grasses, rice hulls, wheat straw, cotton, hemp, flax, sisal, corn cobs, sugar cane bagasse, switch grass and mixtures thereof.
- the term âinducerâ refers to any molecule or compound that positively influences the over-production of any protein (e.g., enzyme) over the corresponding basal level of production.
- inducer-free media refers to media that lack any inducer molecule or compound
- incer-containing media refers to media that comprise one or more inducers
- the term âalcoholâ refers to any compound comprising at least hydroxyl group.
- the term encompasses compounds comprising carbon chain lengths of about one to about twenty.
- the term encompasses compounds comprising carbon lengths greater than twenty.
- the term encompasses, but is not limited to ethanol, methanol, butanol, proponal, fatty alcohols, etc. Indeed, it is intended that the term encompass any compound comprising at least one hydroxyl group, including but not limited to compounds that comprise other constituents.
- ppm parts per million
- M molar
- mM and mmol millimolar
- uM and â M micromolar
- nM nanomolar
- mol molecular weight
- gm and g gram
- mg milligrams
- ug and â g micrograms
- L and l liter
- ml and mL milliliter
- cm centimeters
- mm millimeters
- um and â m micrometers
- RNA deoxyribonucleic acid
- FAR fatty alcohol reductase
- GC-FID gas chromatography-flame ionization detector
- GC-MS gas chromatography-mass spectroscopy
- HPLC high pressure liquid chromatography
- MIBK methyl isobutyl ketone
- PHUSION® PHUSION® is a registered trademark of Thermo Fisher Scientific.
- ARS ARS Culture Collection or NRRL Culture Collection, Peoria, Ill.
- ATCC American Type Culture Collection, Manassas, Va.
- ADM Archer Daniels Midland. Decatur, Ill.
- Axygen Axygen, Inc., Union City, Calif.
- GenScript GenScript, USA Inc., Piscataway, N.J.
- CGSC E.
- HERCULASE® is a registered trademark of Agilent Technologies (Agilent Technologies. Santa Clara, Calif.); (Dual Biosystems (Dual Biosystems AG, Schlieven, Switzerland); Megazyme (Megazyme International Ireland, Ltd., Wicklow, Ireland); Sigma-Aldrich (Sigma-Aldrich, St. Louis, Mo.); BASF (BASF Aktiengesellschaft Corp., Ludwigshafen, Del.); Dasgip (Dasgip Biotools.
- a 400 â L sample was taken off the top organic layer, evaporated under a nitrogen stream and the residue was derivatized with 100 â L N,O-Bis(trimethylsilyl)trifluoroacetamide) (BSTFA) at 37° C. for 1 hour, and then diluted with 100 â L of heptanes before analysis by GC-FID or GC-MS.
- BSTFA N,O-Bis(trimethylsilyl)trifluoroacetamide
- 0.5 mL of the culture medium (after removal of cells by centrifugation) was also extracted with 1 mL methyl t-butyl ether for 1 hr.
- the organic phase was either analyzed directly by GC-FID or GC-MS or derivatized with BSTFA as described above before analysis.
- a 1 â L sample was analyzed by GC-FID with the split ratio 1:10 using the following conditions: GC-6890N from Agilent Technologies equipped with FID detector and HP-5 column (length 30 m, I.D. 0.32 mm, film 0.25 um).
- GC method start at 100° C., increase the temperature with a rate of 25° C./min to 246° C. and hold for 1.96 min. Total run time, 7.8 min.
- This Example describes the design and cloning of an E. coli synthetic promoter containing two PhoB-binding sites (PhoB boxes). In this construct, one of these PhoB boxes overlaps with the â 35 region of the promoter, this PhoB box is referred to herein as the âPho1 promoter.â
- Other features included of this design included: an upstream transcriptional terminator to isolate the promoter from transcription of upstream promoter(s); consensus â 35 and â 10 regions to enhance RNA polymerase binding; 27 bp derived from P1 promoter from the rrnB gene to facilitate transcription initiation; 71 bp derived from rrnB gene, containing the anti-termination signals; 73 bp containing signals to enhance message RNA translation: and regions of homology to the lacI-LacZ genes.
- the nucleotide sequence of the synthetic promoter's DNA is provided below:
- This synthetic DNA was synthesized and cloned by GenScript in a pJETI-2 plasmid into the EcoRV site.
- This Example describes the construction of a DNAS cassette to control fabB with the Pho1 promoter.
- This promoter cassette was designed to modulate the expression level of fabB based on the phosphate levels in the media by replacing the fabB native regulatory region with the kanamycin-Pho1 promoter cassette.
- This cassette contained 40 bp and 31 bp of regions of homology to the E. coli fabB gene, as well as the Pho1 promoter and a kanamycin resistance gene flanked by FLP recombinase target sites (âFRT sitesâ) as shown in FIG. 2 .
- FLP recombinase target sites FLP recombinase target sites
- This cassette was assembled by PCR in 3 steps using the Pho1-promoter cloned in pJETI described in Example 1. The following primers and conditions were used to obtain this cassette.
- the forward oligo (5â² CDX-Pho1 F) (SEQ ID NO:9) containing 33 bases of homology to the kanamycin cassette (including an FRT site) and the reverse oligo (3â² CDX Pho R) (SEQ ID NO:10) containing 40 bases of homology to the native fabB ribosome binding site RBS and 5â² sequence of the FabB chromosomal gene were used.
- the sequences are shown below.
- the expected PCR product was 340 base pairs in length.
- CDX-Pho1 F (SEQ ID NO: 9) AGT ATA GGA ACT TCG AAG CAG CTC CAG CCT ACA AAT AAA AAT GCC AGC CGA TCG GGC TGG 3â² CDX Pho R: (SEQ ID NO: 10) TCA TTC AAT ACC TCT GTA AGT CGC ACA TAG AGT AAG TTT CTG GTG GCG CAT TAT ACC AGC
- the PCR conditions utilized were 1 cycle of 98° C. for 2 minutes, followed by 30 cycles of 98° C. for 10 seconds, 60° C. for 15 seconds, and 72° C. for 20 seconds, followed by a final cycle of 72° C. for 2 minutes.
- the kanamycin cassette was PCR amplified from pKD13 plasmid using the following primers.
- the forward oligo (5â² Kan F) (SEQ ID NO:11) contains 35 bases of homology to sequence upstream of the integration site and the Reverse oligo (3â² Kan R) (SEQ ID NO:12) contains 35 bases of homology to the 5â² sequence of Pho1.
- the expected PCR product was 1380 base pairs in length.
- Kan F (SEQ ID NO: 11) AGG CGG TGG CTC GAT CTT AGC GAT GTG TGT AAG GCT GCG CAT TCC GGG GAT CCG TCG ACC 3â² Kan R: (SEQ ID NO: 12) AAA GGC AAA AAT GCC AGC CCG ATC GGC TGG CAT TTT TAT TTG TAG GCT GGA GCT GCT TCG The PCR protocol utilized:
- the PCR conditions utilized were 1 cycle of 98° C. for 2 minutes, followed by 30 cycles of 98° C. for 10 seconds, 60° C. for 15 seconds and 72° C. for 45 seconds, followed by a final cycle of 72° C. for 2 minutes.
- step 3 both PCR products from the previous two steps were gel purified and used as template to assemble the final integration cassette using the following oligos in splice overlap and extension PCR (SOE).
- SOE splice overlap and extension PCR
- Kan F (SEQ ID NO: 11) AGG CGG TGG CTC GAT CTT AGC GAT GTG TGT AAG GCT GCG CAT TCC GGG GAT CCG TCG ACC 3â² CDX Pho R: (SEQ ID NO: 10) TCA TTC AAT ACC TCT GTA AGT CGC ACA TAG AGT AAG TTT CTG GTG GCG CAT TAT ACC AGC
- the PCR conditions utilized were 1 cycle of 98° C. for 2 minutes, followed by 30 cycles of 98° C. for 10 seconds, 65° C. for 15 seconds, and 72° C. for 1 minute, followed by a final cycle of 72° C. for 2 minutes. After this reaction, the PCR product was purified and desalted through a PCR purification column (Qiagen) and eluted with water.
- the DNA sequence of the final cassette is shown below.
- the regions of homology with the chromosome are shown in bold:
- This Example describes the construction of an E. coli strain with fabB under control of the Pho1 promoter.
- the cassette described in Example 2 was used to replace the native regulatory region of the FabB gene in the chromosome of the E. coli strain W3110K (CGSC), as described below.
- recombinase-induced cells were prepared.
- a single colony of strain W3110K containing plasmid pSIM5 (See, Datta et al., Gene 379:109-115 [2006]) was used to inoculate a 3 ml of LB media (Difco)+30 â g/mL chloramphenicol and cultivated overnight) at 30° C. 350 â L of this overnight culture were added to 40 ml of TB media (Difco)+30 â g/mL chloramphenicol (pre-warmed to 30° C.) in a 250 ml baffled Erlenmeyer flask. The cells were grown at 30° C.
- the supernatant was aspirated and 1 ml of ice-cold sterile distilled H 2 O was added to the cell pellet to resuspend the cells after which, another 40 ml of ice-cold distilled H 2 O was added.
- the tube was centrifuged again as in the previous step (i.e., 10 min at â 4000 â g at 4° C.).
- the resulting 40 ml supernatant was decanted and the pellet was resuspended in 1 ml ice-cold distilled H 2 O.
- the cells were transferred to a pre-chilled microcentrifuge tube and centrifuged for 1 min at â 10,000 â g in a 4° C. refrigerated microcentrifuge.
- the supernatant was aspirated and the wash step was repeated one more time.
- the resulting cell pellet was resuspended in â 250 â l of sterile ice-cold distilled H 2 O and kept on
- electrotransformation of linear PCR product into the recombinase-induced cells was performed by pipetting 1 to 10 â l ( â 100 ng) of salt-free PCR fragment into 50 â l of electrocompetent cells prepared in step 1.
- the cells and DNA mixture were transferred to a 1 mm cuvette on ice and electroporated at 1.7 kV.
- the cells were resuspended in 2 mL of SOC media (Invitrogen) in a new, sterile culture tube. The tubes were then incubated at 37° C. for â 3 hours to allow completion of recombination and expression of the drug-resistance gene.
- the cells were selected for positive integrants.
- 100 â l of the culture obtained after the â 3 hours incubation described above was plated onto agar plates with 20 g/mL kanamycin. Additionally, 1 mL of cells were spun down, resuspended in 100 â l of LB and plated on LA (Difco) plates with 40 â g/mL kanamycin. The plates were incubated at 37° C. overnight. Approximately â 20 colonies per 100 â l of culture were observed.
- FB genome-up (SEQ ID NO: 14) TTG GAA AAA TAG ACA TCG TCA AAA TCT C FB genome-down: (SEQ ID NO: 15) TGC AGC GCA AGG CGA GGA GTA TCC CCG TCT
- the PCR conditions utilized were 1 cycle of 95° C. for 2 minutes, followed by 30 cycles of 95° C. for 20 seconds, 60° C. for 30 seconds, and 72° C. for 3 minutes, followed by a final cycle of 72° C. for 2 minutes.
- Kan 5â² F1 (SEQ ID NO: 16) ATT CCG GGG ATC CGT CGA CC Kan 5â² F2: (SEQ ID NO: 17) GGC ACA ACA GAC AAT CGG CT Kan 5â² F3: (SEQ ID NO: 18) CCT GCT TGC CGA ATA TCA TG CDXPho Seq F1: (SEQ ID NO: 19) GCC TTT AAA TTG GTT TGA CAG CT FabB seqF1: (SEQ ID NO: 20) CGT GCA GTG ATT ACT GGC CTG FabB seqF2: (SEQ ID NO: 21) ATG TGG TCA CCA AAG CGA TG FabB seqF3: (SEQ ID NO: 22) GGT ACT TCG ACT CCG GTT GG FabB seqF4: (SEQ ID NO: 23) CTG GTA ATG CGC AAG CTG AA FabB seqR1: (SEQ ID NO: 24) AAT GCC
- Example 3 experiments conducted using qPCR to quantify the levels of fabB mRNA produced by the strains produced in Example 3 are described.
- the materials included the RNeasy Mini Kit (Qiagen), RNAprotect Bacterial Reagent (Qiagen), mercaptoethanol, ethanol, lysozyme (Sigma), proteinase K (Qiagen), RNAse-Free DNase Set (Qiagen), Zymo-RNA clean and concentrator-5 (Zymo), ImProm-II Reverse Transcription System (Promega), LightCycler 480 SYBR Green Master Mix (Roche), and qPCR primers.
- RNeasy Mini Kit Qiagen
- RNAprotect Bacterial Reagent Qiagen
- mercaptoethanol ethanol
- lysozyme Sigma
- proteinase K Qiagen
- RNAse-Free DNase Set Qiagen
- Zymo-RNA clean and concentrator-5 Zym
- RNA was prepared by adding a sample of culture directly to a tube with 2 volumes RNAprotect bacterial reagent. The contents were mixed and incubated at RT for 5 min. Typically, at an induction OD of â 0.5-0.8, an aliquot of approximately 1-1.5 mL was taken and â 0.25-0.4 mL were sampled at later time points. Each sample was centrifuged for 10 min at 5000 â g and the supernatant was decanted. At this point were frozen at â 80 or used directly in the RNeasy Mini Kit.
- the RNA was prepared as directed in Protocol 4 of the RNeasy manual (enzymatic lysis and proteinase K digestion of bacteria). The RNA was quantitated using a Nanodrop 2000 instrument (Thermo).
- the DNase 1 stock solution was prepared by dissolving the solid powder in 550 uL water by gentle mixing and distributed into 50 uL aliquots which were stored at â 20° C. until use. The DNase reaction utilized â 5 ug RNA, 3 uL RDD buffer, 1 uL DNase 1, and sufficient water to provide 30 uL of solution. The solution was incubated at 37° C. for 30 min. An additional 1 uL DNase was then added and the solution was incubated for another 30 min.
- the reverse transcriptase (RT) reaction was performed using 5 â RT buffer (2.2 ul), 25 mM MgCl 2 (2.2 ul), RNAsin (0.25 ul), water (0.25 ul), and RT (0.5 ul), in a final volume of 5 ul.
- the mixture was incubated at 25° C. for 5 min, 42° C. for 1 hr, 70° C. for 15 min. After this, reactions were kept at 40 until they were used for qPCR reactions.
- the cDNA was diluted 1:20 by adding 95 ul water to the 5 ul RT reaction.
- the qPCR reactions were run in triplicate, using appropriate controls (e.g., at least one no RT reaction and a no template control for each gene tested).
- the folA and the cysG genes were used as standards for normalization.
- DRFR (folA) (endogenous control) (SEQ ID NO: 26) DHFR-F TCTGACGCATATCGACGCAGAAGT (SEQ ID NO: 27) DHFR-R GCCGCTCCAGAATCTCAAAGCAAT CysG (alternative endogenous control) (SEQ ID NO: 28) CysG-F TTGTCGGCGGTGGTGATGTCA (SEQ ID NO: 29) CysG-R ATGCGGTGAACTGTGGAATAA FabB (SEQ ID NO: 30) FabB3F-ATCTCTGCGTGAAGGACGCGTT (SEQ ID NO: 31) FabB3R-ATGAGGCCAGTGGTATCCAG
- the qPCR reaction mix contained 2 â SYBR Master Mix, Roche (10 ul), water (5 ul), 10 uM forward primer (0.5 ul), 10 uM reverse primer (0.5 ul), and cDNA (1:20) (4 ul), to a final volume of 20 ul.
- a LightCycler model 480 (Roche) with a 96-well plate was used to carry out the qPCR reactions. Reactions were run at 95° C. for 5 min, followed by 45 cycles of 95° C. for 10 seconds, 60° C. for 10 seconds, and 72° C. for 10 seconds. The melting curve was determined using 95° C. for 5 seconds, followed by 65° C. for 1 min, and a ramp to 95° C.
- the relative quantitation, 2nd derivative max was used on the Roche480 to determine Cp values.
- the efficiency-corrected delta Ct method as described by Bookout et al.
- fatty alcohols produced by the strains were first removed by extracting them by a dodecane wash using 3 â dodecane (Sigma) per sample volume, vortexed, and the centrifuged for 10 min at 4000 rpm, 4° C. The supernatants were discarded and the cell pellets were washed with M9YE (without glucose) to wash away residual dodecane. The pellets were stored at â 80° C. until further processing.
- lysis buffer 50 mM Tris pH 8.2, 75 mM NaCl, 8M Urea, containing cOmplete Mini EDTA-free protease inhibitor cocktail (Roche) (1 tablet/10 ml buffer).
- This buffer also contained 125 U/ml of Benzonase (EMD).
- EMD Benzonase
- Suspensions were sonicated on ice for 30 sec, and 90 sec chill (repeated 3 times). After lysis, the total protein concentrations were determined using the BCS assay following manufacturer recommendations (AMRESCO). The lysates were stored in â 80° C. until further use.
- BSA GenBank No. P02769: (SEQ ID NO: 32) HLVDEPQNLIK (402-412) (SEQ ID NO: 33) LGEYGFQNALIVR (421-433) (SEQ ID NO: 34) LFTFHADICTLPDTEK (529-544) (SEQ ID NO: 35) RPCFSALTPDETYVPK (508-523) E. coli FabB (GenBank No.
- Strains to be evaluated were first inoculated into 5 ml of 2YT media (16 g/L Bacto tryptone (Difco), 10 g/L Bacto yeast extract (Difco) and 5 g/L NaCL (Sigma), pH 7.0) and grown overnight at 30° C. in a shaker (one inch throw) at 250 rpm. After overnight growth, 2.5 ml were transferred into 50 ml of PMM2 media in 250 ml baffled shake flask (VWR) placed in a shaker at 250 rpm (two inch throw), at 30° C. After three hours of growth, IPTG (1 mM final concentration) was added to induce expression of the FAR enzyme (See, Example 7, below).
- 2YT media 16 g/L Bacto tryptone (Difco), 10 g/L Bacto yeast extract (Difco) and 5 g/L NaCL (Sigma), pH 7.0
- PMM2 media 250 ml baffled shake flask (VWR) placed in
- the fabB gene is an E. coli gene encodes the FabB enzyme involved in fatty acid biosynthesis.
- FabB catalyzes the elongation of Acyl-ACPs to chain lengths up to 16 and 18 carbons, in particular unsaturated fatty acids which are essential for membrane formation.
- FAR fatty alcohol reductase
- Reduction in FabB elongation capacity in cells where FAR is present should have at least two effects: (1) a reduction in the total amount of fatty alcohols that the cells can produce; and (2) as the total activity of FabB decreases after the gene has been repressed, a reduction in the chain length of the fatty alcohols produced by FAR should occur.
- Table 7-1 after 42 h of incubation, the strain where fabB was being expressed from its native promoter, produced â 1.6 g/L of fatty alcohols and the percentage of C12:0 fatty alcohol was â 7%.
- the strain containing fabB under control of the Pho1 promoter produced only â 0.9 g/L of fatty alcohols, and â 47% of the fatty alcohols were C12:0, indicating that the cell's capability to elongate fatty acids was limited.
- the fermentor was inoculated with 80 mL of a late exponential culture of E. coli .
- the inoculum was grown in a 1000 mL baffled shake flask containing 100 mL of 10 g/L D-glucose (Sigma).
- an exponential fed-batch growth phase with a specific growth rate of 0.15 h â 1 was initiated by exponential addition of feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 2 g/L magnesium sulfate to the fermentor.
- the exponential feed profile was maintained for 10 hours.
- the expression of the FAR variant was induced at the end of the exponential fed-batch growth phase by the addition of isopropyl-B-D-thiogalactoside (IPTG, Richman Chemical) to a final concentration of 1 mmol/L.
- fatty alcohol was maintained by a pH-stat protocol using a feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 2 g/L magnesium sulfate (Sigma). The addition of feed solution (60 g of glucose per 1 hour pulse) was triggered when pH spiked above 7.15. In parallel, a 50 g/L potassium phosphate monobasic (Sigma) solution was fed at a constant rate of 0.03 mL/min immediately after IPTG addition until the end of the fermentation. The production of fatty alcohols was maintained for an additional 68 hours at 30° C.
- the inoculum was grown in a 1000 mL baffled shake flask containing 100 mL of 10 g/L D-glucose (Sigma), 6 g/L sodium phosphate dibasic anhydrous (Mallinkrodt), 3 g/L potassium phosphate monobasic anhydrous (Mallinkrodt), 1 g/L ammonium chloride (BDH), 2 g/L Tastone yeast extract (Sensient), 0.5 g/L sodium chloride (Sigma), 100 mg/L spectinomycin (Calbiochem) at 30° C., 250 rpm until the OD600 reached 2-3.
- the fermentor was agitated at 300-1800 rpm and air supplied at 3 slpm to maintain a minimum dissolved oxygen level of 30% of saturation.
- the pH of the culture was controlled at 7.0 by addition of a solution containing 28-30% ammonia (Sigma) in the form of ammonium hydroxide.
- the expression of the FAR variant was induced at the end of the exponential fed-batch growth phase by the addition of isopropyl-B-D-thiogalactoside (IPTG, Richman Chemical) to a final concentration of 1 mmol/L.
- IPTG isopropyl-B-D-thiogalactoside
- Production of fatty alcohol was maintained by a pH-stat protocol using a feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 2 g/L magnesium sulfate (Sigma).
- the addition of feed solution 60 g of glucose per 1 hour pulse was triggered when the pH spiked above 7.15.
- This Example describes experiments conducted to determine the level of control of the Pho1 promoter in larger fermentors.
- the experiment described in Example 7 above indicates that fabB under the Pho1 promoter was repressed by low phosphate conditions.
- 10 L fermentations were carried out according to the procedures described in Example 8 above using the strains described in Example 7.
- the Pho1 promoter was designed to obtain high levels of expression by using the consensus sequences for the â 35 and â 10 regions. In some applications, strong promoters are not needed to express a gene. Thus, in this Example, experiments conducted to design a weaker promoter where the â 35 region, TTGACA was changed to GTGACA (1 bp change) are described. This new promoter is referred to herein as âPho17.â It is known that mutations in the â 35 or â 10 regions or in the DNA between these two regions (i.e., the spacer region), can affect drastically promoter strength (See e.g., Moyie et al., J.
- Pho1 (SEQ ID NO: 4) GTGACAGATATATGACAGGAATTTGACAGATATATGACAGGCTGGTATAA TGCGCCACCA
- Pho17 (SEQ ID NO: 5) GTGACAGATATATGACAGGAATGTGACAGATATATGACAGGCTGGTATAA TGCGCCACCA
- Promoter Pho17 was constructed by mutagenesis of the Km-Pho1 cassette described in Example 2.
- this cassette was converted first into a replicating plasmid by ligating it with the R6K origin of replication (R6Kori).
- the R6Kori was obtained by PCR using the R6KF1 and R6KR1 primers, and plasmid pKD32 obtained from the E. coli Stock Center as template.
- R6KF1 (SEQ ID NO: 42) 5â² CTGTCAGCCGTTAAGTGTTCCTGTGTG R6KR1: (SEQ ID NO: 43) 5â² CAGTTCAACCTGTTGATAGTACG
- SEQ ID NO: 42 5â² CTGTCAGCCGTTAAGTGTTCCTGTGTG R6KR1: (SEQ ID NO: 43) 5â² CAGTTCAACCTGTTGATAGTACG
- PCR conditions were: 1 cycle of 98° C. for 30 seconds, followed by 25 cycles of 98° C. for 30 seconds and 60° C. for 30 seconds, seconds, followed by a final cycle of 72° C. for 2 minutes.
- This PCR product was purified and ligated to the cassette described in Example 2, using the Quick Ligation kit (New England BioLabs), following the manufacturer's protocol. Ligated products were transformed into PIR1 competent cells accordingly manufacturer recommended procedure (Invitrogen). After transformation, cells were plated on LA (Difco) plates containing 25 ug/ml Km. One colony from these plates was used to purify the plasmid Pho1-R6K.
- Plasmid Pho1-R6K was used as template for mutagenesis using the QuikChange kit (Agilent).
- the oligo (PhoBboxTtoGF) was used to change the nucleotide at the 5â² end of PhoB Box from T to G.
- PhoBboxTtoGF (SEQ ID NO: 44) ATATGACAGGAATGTGACAGA
- the mutagenesis protocol was carried out as recommended by the supplier, except that in the last step.
- PIR1 cells were used to transform the mutated plasmid.
- a plasmid containing the proper modification was identified by sequencing and named pPho17-R6K.
- the DNA sequence of the mutated cassette is shown below, with the primer sequence underlined and the modified base in bold within the underlined region.
- E. coli strain W3110K-D4 Experiments conducted to construct the E. coli strain W3110K-D4 are described in this Example. This strain was designed to be suitable for large-scale fermentation processes. The following deletions were made to the starting E. coli W3110K (CGSC) strain: â fhuA; â ldhA; â adhE and genes involved in colanic acid biosynthesis â wza-wcaM. Each of the four deletions was carried out in a two-step process using lambda-RED technology known in the art (See, Datta et al., Gene 379:109-115 [2006]). In the first step, the gene(s) of interest was/were replaced with a dsDNA cassette encoding a kanamycin resistance marker (Km).
- Km kanamycin resistance marker
- the Km marker was seamlessly removed from the genome using a ssDNA oligo using methods known in the art (See, Datta et al., supra). To exemplify this process, the deletion of the fhuA gene is described below.
- a dsDNA kanamycin resistance cassette was first PCR amplified from plasmid pKD13 (CGSC) using the following primers:
- fhuA-deletion_F (SEQ ID NO: 46) 5â²- ACGTTATCATTCACTTTACATCAGAGATATACCAATGGCGATTCCGGGGA TCCGTCGACC-3â²
- fhuA-deletion_R (SEQ ID NO: 47) 5â²- AGAGAAATTAGAAACGGAAGGTTGCGGTTGCAACGACCTGTGTAGGCTGG AGCTGCTTCG-3â²
- the PCR reaction was carried out using the enzyme PHUSION® DNA polymerase (New England BioLabs) with an initial denaturation step at 98° C. for 30 sec, followed by 30 cycles of the steps: 98° C. for 5 sec, 63° C. for 20 sec and 72° C. for 40 sec. This was followed by a final elongation step at 72° C. for 5 min.
- the PCR product was purified through a PCR purification column (Qiagen) and eluted with water.
- Strain W3110K was transformed with plasmid pSIM5 (Datta et al., supra). Homologous recombination-proficient electrocompetent cells were prepared as described by Datta et al., (supra), and were transformed with 500 ng of the kanamycin cassette from above. Cells were recovered at 32° C. for three hours, plated on LB agar plates containing 20 micrograms/ml of kanamycin, and incubated 24 hours at 32° C.
- a single colony was streaked onto a fresh LB agar plate with 30 micrograms/ml chloramphenicol (to maintain the pSIM5 plasmid) and a purified colony confirmed to have the fhuA gene replaced with the kanamycin cassette was named W3110K- â fhuA::Km.
- kanamycin marker was removed from the above cells using homologous recombination with a ssDNA oligonucleotide.
- Homologous recombination proficient electrocompetent cells were prepared from strain W3110K- â fhuA::Km with the pSIM5 plasmid as described above and the cells were transformed with 500 ng of the oligonucleotide (fhuA(2-10)_del_oligo) shown below.
- the â*â indicates the presence of phosphorothioate bonds.
- This oligonucleotide contains four bases that were modified during synthesis of the oligonucleotide by the manufacturer (GenScript). It is known that these modifications make the oligonucleotide resistant to certain cellular nucleases.
- fhuA(2-10)_del_oligo (SEQ ID NO: 48) 5â²- A*G*A*G*AAATTAGAAACGGAAGGTTGCGGTTGCAACGACCTGCCAT TGGTATATCTCTGATGTAAAGTGAATGATAACGT-3â²
- the final strain was confirmed by DNA sequencing to have seamless deletions of all four loci and was named âW3110K- â 4â (W3110K- â fhuA- â ldhA- â adhE- â wza-wcaM).
- Medium M9YE has the following composition:
- a single E. coli colony was used to inoculate each well of a 96-well plate filled with 180 ul/well of M9YE media (with 1% glucose and a selection antibiotic).
- the plate was grown overnight (18-20 hrs) at 30° C., 85% relative humidity and shaking at 200 rpm. Once the cells reached saturation, 5% of the overnight growth was used to inoculate a 96-well plate filled with 380 ul/well of M9YE media containing 5% glucose and the selection antibiotic.
- the plate was placed in a shaker set to 250 rpm, 30° C. with a two inch throw. After two hours of growth. IPTG (1 mM final concentration) was added to induce the FAR enzyme.
- the deep-well plate containing the constructs remained in the shaker for â 72 hrs. 1 mL of methyl isobutyl ketone (MIBK) was added to each well, and the plate was shaken vigorously (setting at 10 for a desktop plate shaker) for at least 2.5 hrs. The plate was centrifuged at 4000 rpm at 4° C. for 10 min. 200 â l per well was transferred to a 96-well round bottom plate and analyzed via GC-FID to evaluate the fatty alcohol total titers and composition.
- MIBK methyl isobutyl ketone
- the fabA gene is an essential E. coli which encodes an enzyme with two catalytic activities, namely a 3-hydroxyl-acyl-ACP dehydratase and a trans- â 2-decenoyl-ACP to cis- â 3-decenoyl-ACP isomerase activity.
- This isomerase function is essential for the biosynthesis of unsaturated fatty acids.
- the Km-Pho17 cassette described in Example 10 was integrated in front of the fabA gene in the chromosome of strain W3110K- â 4 strain (See, Example 11).
- the Km-Pho1 cassette See, Example 2 was cloned in front of fabA in another strain.
- the Km-Pho1-fabA and Km-Pho17-fabA cassettes were generated by PCR using the pPho1-R6K or pPho17-R6K plasmids (described in Example 10), with primers FabAPhoR and ycgKanF.
- ycgKanF (SEQ ID NO: 58) GGCCATTACGTTGGCTGAACTGGTTTATTCCGAACTGATCATTCCGGGGA TCCGTCGACC FabAPhoR: (SEQ ID NO: 59) GTTTATCTACCATGTTCTCTGTAAGCCTTATTTTATTGAAGTGGTGGCGC ATTATACCAGC
- ycbzckF (SEQ ID NO: 60) TGGCGAAGGCCAAACGACGC fabAseqR: (SEQ ID NO: 61) TCATCAGCATGTTCGGTGCTGGC
- This Example describes experiments to evaluate strains containing fabA under control of either the Pho1 or Pho17 promoter.
- the strains described in Example 13 were grown according to the plate protocol described in Example 12, and total fatty alcohol (FOH) concentrations and saturation levels were analyzed.
- FOH total fatty alcohol
- Table 14-1 the strains with fabA under control of its native promoter or the Pho1 promoter produced the same amount of fatty alcohols, with very similar saturation levels.
- the percentage of saturation indicated in this table is the sum of C12:0, C14:0, and C16:0 fatty alcohols.
- the strain with the Pho17-fabA construction produced 25% less fatty alcohols and these fatty alcohols had a higher saturation level.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Fertilizers (AREA)
Abstract
The present invention provides compositions and methods comprising a low-phosphate repressible promoter. In particular, the present invention provides a low-phosphate repressible promoter from E. coli.
Description CROSS-REFERENCE TO RELATED APPLICATION
The present application is a national stage application filed under 35 USC §371 and claims priority to international application to PCT International Application No. PCT/US2014/025332, filed Mar. 13, 2014 which claims priority to US Provisional Application. Ser. No. 61/783,641, filed Mar. 14, 2013, both of which are incorporated by reference, in their entireties and for all purposes.
REFERENCE TO A âSEQUENCE LISTING,â A TABLE, OR A COMPUTER PROGRAM LISTING APPENDIX SUBMITTED AS AN ASCII FILE
The Sequence Listing written in file CX5-130WO1_ST25.TXT, created Mar. 11, 2014, 32,178 bytes, machine format IBM-PC, MS-Windows operating system, is hereby incorporated by reference.
FIELD OF THE INVENTION
The present invention provides compositions and methods comprising a low-phosphate repressible promoter. In particular, the present invention provides a low-phosphate repressible promoter from E. coli.
BACKGROUND OF THE INVENTION
Various bacterial expression control DNA sequences have been used to control the expression of foreign (i.e., heterologous) polynucleotide by transformed bacteria, as well as control expression of homologous genes. Indeed, with advances in genetic engineering in recent years, it has become possible to produce proteins in economically desirable quantities using various organisms as host cells. Escherichia coli (E. coli) is widely employed as a host cell in protein production systems, as it has a short generation period of about 20 minutes and can utilize a variety of sugars to proliferate. Furthermore, a large number of plasmid vectors have been developed that are useful in E. coli. The rapid and stable industrial production of recombinant proteins has been achieved with host-vector systems employing E. coli as host cell. Nonetheless, there remains a need to better control bacterial gene expression, particularly in commercial process systems.
SUMMARY OF THE INVENTION
The present invention provides compositions and methods comprising a low-phosphate repressible promoter. In particular, the present invention provides a low-phosphate repressible promoter from E. coli. In some embodiments, the present invention provides methods for controlling the expression of at least one product of interest through the modulation effects of a low-phosphate repressible promoter as provided herein. Indeed, it is intended that the present invention provide advantages in the selective expression of genes of interest. In some embodiments, the present invention provides means to silence (i.e., âturn offâ) the expression of certain genes during the growth of a microbial culture, as desired.
The present invention provides recombinant microorganisms comprising a desired phenotype, wherein the desired phenotype is obtained by exposing the microorganisms to conditions of limited phosphate concentration. In some embodiments, the genome of the microorganism comprises at least one mutation that alters the phosphate sensitivity of the microorganism. In some further embodiments, the microorganism comprises at least one mutation in pstS. In some additional embodiments, the pstS mutation is selected from T10M, T10Y, D56S, and/or T139H. In some further embodiments, the pstS mutations are selected from T10M, T10Y, D56S, and/or T139H, wherein the amino acid positions are numbered with reference to SEQ ID NO:3. In some still further embodiments, the recombinant microorganism is present within a culture medium and the desired phenotype is obtained by the expression of at least one gene under the control of at least one heterologous regulatory sequence and the heterologous regulatory sequence responds to the phosphate concentration of the culture medium. In some embodiments, the microorganism comprises the Pho1 and/or Pho17 promoter. In some embodiments, the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4. In some additional embodiments, the recombinant microorganism comprises the Pho17 sequence set forth in SEQ ID NO:5. In some further embodiments, the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4 and/or the Pho17 sequence set forth in SEQ ID NO:5. In still some additional embodiments, the microorganism is E. coli.
The present invention also provides methods for producing at least one heterologous polypeptide, comprising culturing a recombinant microorganism comprising at least one polynucleotide sequence encoding at least one heterologous polypeptide in a culture medium comprising a low concentration of phosphate, such that at least one polynucleotide is expressed and at least one heterologous polypeptide is produced. In some embodiments, at least one heterologous polypeptide is encoded by a heterologous gene wherein the heterologous gene comprises at least one mutation in the regulatory region of the gene. In some embodiments, the methods further comprise the step of recovering at least one polypeptide. In some embodiments, the recombinant microorganism comprises at least one mutation in pstS. In some further embodiments, the pstS mutations are selected from T10M, T10Y, D56S, and/or T139H. In some further embodiments, the pstS mutations are selected from T10M, T10Y, D56S, and/or T139H, wherein the amino acid positions are numbered with reference to SEQ ID NO:3. In some additional embodiments, the recombinant microorganism comprises the Pho1 and/or Pho17 promoter(s). In some embodiments, the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4. In some further embodiments, the recombinant microorganism comprises the Pho17 sequence set forth in SEQ ID NO:5. In still some additional embodiments, the recombinant microorganism comprises the Pho1 sequence set forth in SEQ ID NO:4 and the Pho17 sequence set forth in SEQ ID NO:5. In some embodiments, the microorganism is E. coli. In some additional embodiments, the recombinant microorganism produces an increased yield of at least one heterologous polypeptide, as compared to a recombinant microorganism that does not comprise at least one repressible promoter. In some further embodiments, the recombinant microorganism produces an increased yield of at least one product, as compared to a recombinant microorganism that does not comprise a repressible promoter. In some embodiments, the product comprises at least one alcohol. In some further embodiments, at least one heterologous polypeptide is selected from eukaryotic and prokaryotic polypeptides.
The present invention also provides a low-phosphate repressible promoter comprising Pho1. In some embodiments, the Pho1 promoter comprises SEQ ID NO:4. In some additional embodiments, the present invention further provides a low-phosphate repressible promoter comprising Pho17. In some embodiments, the Pho17 promoter comprises SEQ ID NO:5.
The present invention further provides expression constructs comprising at least one low-phosphate repressible promoter. In some embodiments, the expression constructs comprise the Pho1 promoter and/or Pho17 promoter. In some further embodiments, the Pho1 promoter comprises SEQ ID NO:4. In some additional embodiments, the Pho17 promoter comprises SEQ ID NO:5.
The present invention also provides recombinant host cells comprising at least one low-phosphate repressible promoter, wherein the promoter is the low-phosphate repressible promoter Pho1 and/or Pho17. In some further embodiments, the Pho1 promoter comprises SEQ ID NO:4. In some additional embodiments, the Pho17 promoter comprises SEQ ID NO:5. In some embodiments, the host cell exhibits a desired phenotype.
BRIEF DESCRIPTION OF THE FIGURES
FIG. 1 provides partial DNA sequence of promoters Pho1 (SEQ ID NO:4) and Pho17 (SEQ ID NO:5). In this Figure, the arrows indicate the position and orientation of the Pho boxes according to Diniz et al. (Diniz et al., J. Bact. 193: 6929-6938 [2011]). The base changed in Pho17 is shown in italics. The â35 and â10 regions of the promoter are also indicated.
FIG. 2 provides a schematic showing the construction of a kanamycin-Pho1 promoter cassette as described in Example 2.
DESCRIPTION OF THE INVENTION
Proper control of gene expression is essential for the development of economically viable biotechnological commercial processes. A major consideration is that the cell's machinery is required to overproduce one and often more than one product in quantities that are commercially relevant. However, under normal circumstances, cells utilize various mechanisms that avoid the excessive production of any molecule that is not needed by the cell. One of these mechanisms is the tight regulation of gene expression, achieved by controlling activity of transcriptional promoters. A transcriptional promoter (herein referred as a âpromoterâ), is the region of the chromosome where the RNA polymerase binds, in order to initiate DNA transcription, thereby producing RNA capable of performing a biological function. Promoter activity is controlled by activation and/or repression mechanisms that enhance or decrease the promoter's capacity to drive RNA production. In most biotechnological processes utilizing E. coli as the production host, strong promoters are routinely used. These promoters are typically controlled by the binding of a repressor which inhibits the productive interaction of RNA polymerase with the promoter.
The most widely used promoter system in E. coli and other bacteria is the Lac promoter (Plac) and its repressor LacI. This system is commonly induced in the laboratory by the addition of the gratuitous inducer, isopropyl-beta-D-thio-galactosidase (IPTG). Another common expression system in E. coli is derived from the PhoA and PstS promoters, which are activated by the PhoB protein only when the level of phosphate (Pi) in the growth media is low. The use of phosphate as a way to modulate gene expression is particularly useful because phosphate is normally added to most growth media, and its levels can be easily controlled. In many bacteria, assimilation of phosphorus-containing compounds depends on the extracellular Pi concentration and is based on a sensing mechanism controlled by a two-component regulatory system. In E. coli and some other species, the system is encoded by the phoB and phoR genes. PhoR is a sensor histidine kinase that monitors the extracellular availability of phosphate, while PhoB is the response regulator that controls gene expression. The E. coli response to low-phosphate conditions involves PhoR autophosphorylation and the transfer of Pi to PhoB. Phosphorylated PhoB(PhoBËPi) binds with higher affinity than non-phosphorylated PhoB to DNA and exerts its regulatory function on gene expression. In E. coli, PhoBËPi activates the expression of a more than 40 genes (i.e., the Pho regulon) by binding to conserved 18-bp DNA sequences referred to as âPho boxesâ located upstream of the promoters of the Pho regulon genes (See e.g., Hasieh and Wanner. Curr. Opin. Microbiol., 13:198-203 [2010]). The E. coli consensus Pho box CT(G or T)TCAT A(A or T)A (A or T) CTGTCA(T OR C) (SEQ ID NO: 1) consist of two 7-bp directed repeats separated by a conserved 4-bp AT rich spacer (See, Blanco et al., Structure 10:701-713 [2002]; and Diniz et al., J. Bact., 193:6929-6938 [2011]).
As described herein, the use of a low-phosphate repressible promoter is useful when gene(s) need to be turned off (e.g., because their product is not needed) and/or the presence of the gene product interferes with the over-production of a desired product. Indeed, as described herein, the present invention provides new promoter systems for E. coli that can be repressed by low phosphate conditions.
In some additional embodiments, the phosphate sensor mechanism of a host cell is modified. Although it is not intended that the present invention be limited to any particular mechanism(s), mutations in the phosphate-binding pocket of the PstS sensor of E. coli can affect its affinity for phosphate and as a consequence, the sensitivity of the sensor mechanism (See e.g., U.S. Pat. No. 5,304,472; Yao et al., Biochem., 35:2079-2085 [1996]. Any suitable method for introducing mutations in the endogenous E. coli pstS gene find use in the present invention, including but not limited to oligonucleotide site-directed mutagenesis using the lambda RED recombineering technology as described herein. In some additional embodiments, mutations in one or more genes involved in the inorganic phosphate sensing mechanism (e.g., phoB, phoR, phoU pstsA, pstB, pstC, and/or pstS) find use in altering the phosphate sensitivity of host strains produced using the present invention. It is not intended that the present invention be limited to any particular mutations in any particular gene(s) nor any specific culture conditions. In some embodiments, the host strain is E. coli. Indeed, it is intended that the present invention find use in the production of any suitable heterologous polypeptide(s) by bacteria comprising at least one phosphate-repressible promoter of the present invention.
Definitions:
Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Generally, the nomenclature used herein and the laboratory procedures of cell culture, molecular genetics, microbiology, organic chemistry, analytical chemistry, and nucleic acid chemistry described below are well known and commonly employed in the art. Such techniques are well-known and described in numerous texts and reference works well known to those of skill in the art. All patents, patent applications, articles and publications mentioned herein, both supra and infra, are hereby expressly incorporated herein by reference.
Although any suitable methods and materials similar or equivalent to those described herein find use in the practice of the present invention, some methods and materials are described herein. It is to be understood that this invention is not limited to the particular methodology, protocols, and reagents described, as these may vary, depending upon the context they are used by those of skill in the art. Accordingly, the terms defined immediately below are more fully described by reference to the application as a whole.
Also, as used herein, the singular âaâ, âan,â and âtheâ include the plural references, unless the context clearly indicates otherwise. Numeric ranges are inclusive of the numbers defining the range. Thus, every numerical range disclosed herein is intended to encompass every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein. It is also intended that every maximum (or minimum) numerical limitation disclosed herein includes every lower (or higher) numerical limitation, as if such lower (or higher) numerical limitations were expressly written herein. Furthermore, the headings provided herein are not limitations of the various aspects or embodiments of the invention which can be had by reference to the application as a whole. Nonetheless, in order to facilitate understanding of the invention, a number of terms are defined below. Unless otherwise indicated, nucleic acids are written left to right in 5â² to 3â² orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
As used herein, the term âcomprisingâ and its cognates are used in their inclusive sense (i.e., equivalent to the term âincludingâ and its corresponding cognates).
As used herein, the term âphosphate depletionâ refers to a marked decrease in phosphate in the media, as compared to the phosphate concentration routinely used in culture media. As is known in the art, depending upon the E. coli strain used, the inoculum size, the initial phosphate concentration and the pH of the growth medium, the PhoB-PhoR system is induced when the phosphate concentration is below about 50 micromolar (See e.g., Lubke et al., Enz. Microb. Technol., 17:923-928 [1995]). However, it is also known that under some conditions, maximal induction is obtained when the phosphate concentration is less than about 4 micromolar (See e.g., Hasieh and Wanner, supra). Thus, it is not intended that the present invention be limited to any specific initial or process phosphate concentration, particular bacterial strain, or other growth conditions. Those of skill in the art understand how to modify the conditions to optimize the performance of the strain being used.
As used herein, âphosphate-binding regionâ is the region of a protein that binds to phosphate.
As used herein, the E. coli âPstS proteinâ refers to the protein encoded by the âPstS geneâ in bacterial cells, including but not limited to the Enterobacteriaceae (e.g., E. coli). In some embodiments, the E. coli PstS comprises the following polypeptide and polynucleotide sequences, respectively:
MKVMRTTVATVVAATLSMSAFSVFAEASLTGAGATFPAPVYAKWADTYQK ETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTV IGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKL PSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGK GNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFA NAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLK FFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY atgAAAGTTATGCGTACCACCGTCGCAACTGTTGTCGCCGCGACCTTATC GATGAGTGCTTTCTCTGTGTTTGCAGAAGCAAGCCTGACAGGTGCAGGTG CAACCTTCCCTGCGCCGGTGTATGCCAAATGGGCTGACACTTACCAGAAA GAAACCGGTAATAAAGTTAACTACCAGGGTATCGGTTCTTCCGGTGGCGT AAAACAGATTATCGCTAATACCGTTGATTTTGGTGCCTCTGACGCGCCGC TGTCTGACGAAAAACTGGCTCAGGAAGGTCTGTTCCAGTTCCCGACCGTG ATTGGCGGCGTGGTGCTGGCGGTTAACATTCCAGGGCTGAAGTCTGGCGA ACTGGTGCTGGATGGTAAAACCCTCGGCGACATCTACCTGGGCAAAATCA AGAAGTGGGATGATGAAGCCATCGCCAAACTGAATCCGGGTCTGAAACTG CCTTCACAAAACATTGCTGTAGTACGCCGCGCAGATGGCTCCGGGACTTC CTTCGTCTTCACCAGCTACCTGGCGAAAGTGAACGAAGAGTGGAAAAACA ACGTTGGTACTGGCTCTACCGTAAAATGGCCGATCGGTCTGGGCGGTAAA GGTAACGACGGTATCGCCGCGTTCGTTCAGCGTCTGCCGGGTGCAATTGG TTATGTTGAATATGCTTACGCGAAGCAGAACAACCTGGCGTACACCAAAC TGATCTCCGCTGATGGTAAACCGGTTAGTCCGACCGAAGAAAACTTCGCT AATGCAGCAAAAGGTGCAGACTGGAGCAAAACCTTCGCTCAGGATCTGAC CAACCAGAAAGGCGAAGATGCATGGCCTATTACCTCTACCACGTTCATTC TGATCCACAAAGATCAGAAGAAACCAGAACAAGGCACAGAAGTGCTGAAA TTCTTCGACTGGGCGTACAAAACCGGGGCTAAACAGGCGAACGACCTGGA TTACGCCAGCCTGCCGGATAGTGTAGTTGAACAGGTTCGCGCTGCGTGGA AGACCAATATTAAAGACAGTAGCGGTAAGCCGCTGTACtaa
As used herein, the terms âenzyme variantâ and âvariant enzyme,â including âPstS variantâ are used in reference to enzymes that are similar to a reference enzyme, particularly in their function, but have mutations in their amino acid sequence that make them different in sequence from the wild-type or another reference enzyme. Enzyme variants can be made by a wide variety of different mutagenesis techniques well known to those skilled in the art. In addition, mutagenesis kits are also available from many commercial molecular biology suppliers. Methods are available to make specific substitutions at defined amino acids (site-directed), specific or random mutations in a localized region of the gene (regio-specific) or random mutagenesis over the entire gene (e.g., saturation mutagenesis). Numerous suitable methods are known to those in the art to generate enzyme variants, including but not limited to site-directed mutagenesis of single-stranded DNA or double-stranded DNA using PCR, cassette mutagenesis, gene synthesis, error-prone PCR, shuffling, and chemical saturation mutagenesis, or any other suitable method known in the art. After the variants are produced, they can be screened for any suitable desired property.
As used herein, the term âpromoterâ refers to transcriptional promoters (i.e., sequences that direct the transcription of polynucleotides).
As used herein, a âpromoter sequenceâ is a nucleic acid sequence that is recognized by a host cell for expression of the coding region. The control sequence may comprise an appropriate promoter sequence. The promoter sequence contains transcriptional control sequences that mediate the expression of the polypeptide. The promoter may be any nucleic acid sequence which shows transcriptional activity in the host cell of choice including mutant, truncated, and hybrid promoters, and may be obtained from genes encoding extracellular or intracellular polypeptides either endogenous or heterologous to the host cell.
As used herein, âbacterial promoterâ refers to a promoter that is capable of initiating transcription in bacterial cells. In some embodiments, the promoter is capable of modulating the transcription of at least one polynucleotide. In some embodiments, the bacterial promoter is an E. coli promoter.
As used herein, a ârepressible promoterâ is a promoter that exhibits a reduced capacity to function under certain conditions.
As used herein, a âphosphate-regulated promoterâ is a transcriptional promoter, wherein the promoter's capacity to function is regulated by the phosphate level in the growth media used to culture the cells in which the promoter resides.
As used herein, âphosphate sensitivityâ refers to the effects of phosphate in media on a phosphate-regulated promoter. In some embodiments, the promoters are relatively insensitive to the phosphate concentration (i.e., the phosphate concentration has no impact on the activity of the promoter), while in some other embodiments, the promoters are very sensitive to the phosphate concentration (i.e., the phosphate concentration greatly influences the activity of the promoter).
As used herein, a âlow-phosphate-repressible promoter,â is a transcriptional promoter, wherein the promoter's capacity to function is reduced under low-phosphate conditions, as compared to the promoter's functional capacity under conditions in which the phosphate in the growth medium used to culture the bacteria comprising the promoter is in high concentration, such as in growth media that are commonly used to culture bacteria.
As used herein, the term âlow-phosphate conditionsâ refer to a phosphate concentration in growth media lower than about 50 micromolar.
As used herein, the term âinducible promoterâ refers to a transcriptional promoter, wherein the promoter's capacity to function efficiently, requires the presence or absence of chemical or physical factors. Thus, in some embodiments, the inducible promoter's activity is influenced by certain conditions (e.g., light, temperature, chemical concentration, protein concentration, etc.).
As used herein, the term âconstitutive promoterâ refers to promoters that actively promote transcription under most, but not necessarily all environmental conditions and/or states of cell development and/or differentiation.
As used herein, âoptional promoter fragmentsâ refer to any sub-sequence(s) of a promoter that is/are not required for driving transcription of an operably linked coding region. In some embodiments, these fragments comprise the 5â² UTR (i.e., 5â² untranslated region), as well as any exon(s) of the endogenous coding region. In some further embodiments, optional promoter fragments comprise any exon(s) and the 3â² or 5â² of the gene residing upstream of the promoter (i.e., 5â² to the promoter). The term also encompasses any intervening sequences (i.e., introns), as well as sequence that occurs between exons or an exon and the UTR.
As used herein, the term âpreferential transcriptionâ refers to transcription that occurs in response to specific stimuli (e.g., low or high phosphate concentrations). Preferential transcription can be assessed by measuring initiation, rate, and/or transcription levels.
As used herein, the term âmodulate transcriptionâ refers to the activity of a promoter sequence to affect up- and down-regulation of transcription initiation, rate of transcription, and/or transcription levels, as well as any other relevant biological activity.
As used herein, the term âtranscription start siteâ refers to the point at which transcription is initiated on a polynucleotide.
As used herein, the term âphenotypeâ refers to the observable characteristics of a strain. These characteristics result from the expression of the strain's genes, as well as the influence of environmental factors and the interactions between the two. Examples of phenotypes include but are not limited to the growth rate of a strain under a particular set of conditions; the ability of a strain to use glucose as a carbon source; and/or the capability of a strain to express certain gene(s) under low-phosphate growth conditions.
As used herein, a âdesired phenotypeâ is a particular phenotype that is obtained by at least one genetic modification of a strain. Thus, the desired phenotype is different from the strain's phenotype prior to the genetic modification(s). For example, in some embodiments, the starting (i.e., parent) strain is capable of expressing certain genes under low phosphate conditions and the desired phenotype is a strain unable to express such genes under the same growth conditions. In some additional embodiments, the parent strain is capable of expressing certain genes under high phosphate conditions and the desired phenotype is a strain unable to express such genes under the same growth conditions.
As used herein, âpathwayâ refers to a set of system components that are involved in at least two sequential interactions that result in the production of a product and/or activity. The term encompasses various pathway types, including but not limited to biochemical pathways, gene expression pathways, regulatory pathways, and/or a combination of these exemplary pathway types.
As used herein, the term âpublic sequenceâ refers to any sequence deposited in a publicly accessible database. The term encompasses amino acid and nucleotide sequences. Examples of publicly available databases include, but are not limited to the NCBI FTP website, GenBank, European Bioinformatics Institute (EBI-EMBL), DNA Database of Japan (DBBJ), and Brookhaven Protein Data Bank (PDB), as well as the databases associated with patent offices (e.g., the US Patent & Trademark Office).
The terms âpolynucleotideâ and ânucleic acidâ, used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. These terms include, but are not limited to, single-, double- or triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, polymers comprising purine and pyrimidine bases, and/or other natural, chemically, biochemically modified, non-natural or derivatized nucleotide bases. The following are non-limiting examples of polynucleotides: genes, gene fragments, chromosomal fragments, ESTs, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. In some embodiments, polynucleotides comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracyl, other sugars and linking groups such as fluororibose and thioate, and/or nucleotide branches. In some alternative embodiments, the sequence of nucleotides is interrupted by non-nucleotide components.
As used herein, the terms âDNA constructâ and âtransforming DNAâ are used interchangeably to refer to DNA that is used to introduce sequences into a host cell or organism. The DNA may be generated in vitro by PCR or any other suitable technique(s) known to those in the art. In some embodiments, the DNA construct comprises a sequence of interest (e.g., as an âincoming sequenceâ). In some embodiments, the sequence is operably linked to additional elements such as control elements (e.g., promoters, etc.). In some embodiments, the DNA construct further comprises at least one selectable marker. In some further embodiments, the DNA construct comprises an incoming sequence flanked by homology boxes. In some further embodiments, the transforming DNA comprises other non-homologous sequences, added to the ends (e.g., stuffer sequences or flanks). In some embodiments, the ends of the incoming sequence are closed such that the transforming DNA forms a closed circle. The transforming sequences may be wild-type, mutant or modified. In some embodiments, the DNA construct comprises sequences homologous to the host cell chromosome. In some other embodiments, the DNA construct comprises non-homologous sequences. Once the DNA construct is assembled in vitro, it may be used to: 1) insert heterologous sequences into a desired target sequence of a host cell; 2) mutagenize a region of the host cell chromosome (i.e., replace an endogenous sequence with a heterologous sequence); 3) delete target genes; and/or 4) introduce a replicating plasmid into the host. In some embodiments, the incoming sequence comprises at least one selectable marker. This sequence can code for one or more proteins of interest. It can have other biological functions. In many cases the incoming sequence comprises at least one selectable marker, such as a gene that confers antimicrobial resistance.
As used herein, the terms âexpression cassetteâ and âexpression vectorâ refer to nucleic acid constructs generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell. The recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment. Typically, the recombinant expression cassette/vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter. In some embodiments, expression vectors have the ability to incorporate and express heterologous DNA fragments in a host cell. Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those of skill in the art. The term âexpression cassetteâ is used interchangeably herein with âDNA construct,â and their grammatical equivalents. Selection of appropriate expression vectors is within the knowledge of those of skill in the art.
As used herein, the term âvectorâ refers to a polynucleotide construct designed to introduce nucleic acids into one or more cell types. Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, cassettes and the like. In some embodiments, the polynucleotide construct comprises a DNA sequence encoding the enzyme (e.g., precursor or mature enzyme) that is operably linked to a suitable prosequence capable of effecting the expression of the DNA in a suitable host.
As used herein, âa secretion signal peptideâ can be a propeptide, a prepeptide or both. For example, the term âpropeptideâ refers to a protein precursor that is cleaved to yield a mature protein. The term âprepeptideâ refers to a polypeptide synthesized with an N-terminal signal peptide that targets it for secretion. Accordingly, a âpre-pro-peptideâ is a polypeptide that contains a signal peptide that targets the polypeptide for secretion and which is cleaved off to yield a mature polypeptide. Signal peptides are found at the N-terminus of the protein and are typically composed of between about 3 to about 136 basic and hydrophobic amino acids.
As used herein, the term âplasmidâ refers to a circular double-stranded (ds) DNA construct used as a cloning vector, and which forms an extrachromosomal self-replicating genetic element in some eukaryotes or prokaryotes, or integrates into the host chromosome.
As used herein in the context of introducing a nucleic acid sequence into a cell, the term âintroducedâ refers to any method suitable for transferring the nucleic acid sequence into the cell. Such methods for introduction include but are not limited to protoplast fusion, transfection, transformation, conjugation, transduction, and electroporation.
As used herein, the terms âtransformedâ and âstably transformedâ refers to a cell that has a non-native (i.e., heterologous) polynucleotide sequence integrated into its genome or as an episomal plasmid that is maintained for at least two generations.
As used herein, the terms âcontrol sequencesâ and âregulatory sequencesâ refer to nucleic acid sequences necessary and/or useful for expression of a polynucleotide encoding a polypeptide. In some embodiments, control sequences are native (i.e., from the same gene) or foreign (i.e., from a different gene) to the polynucleotide encoding the polypeptide. Control sequences include, but are not limited to leaders, polyadenylation sequences, propeptide sequences, promoters, signal peptide sequences, and transcription terminators. In some embodiments, at a minimum, control sequences include a promoter, and transcriptional and translational stop signals. In some embodiments, control sequences are provided with linkers for the purpose of introducing specific restriction sites facilitating ligation of the control sequences with the coding region of the polynucleotide encoding the polypeptide.
As used herein, âoperably linkedâ refers to a configuration in which a control sequence is appropriately placed (i.e., in a functional relationship) at a position relative to a polynucleotide of interest such that the control sequence directs or regulates the expression of the polynucleotide and/or polypeptide of interest. Thus, a nucleic acid is âoperably linkedâ to another nucleic acid sequence when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA encoding a secretory leader (i.e., a signal peptide), is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, âoperably linkedâ means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
âInactiveâ or âinactivatedâ in reference to a gene refers to a gene having at least one function that is impaired. Genes can be inactivated in a variety of ways known in the art, including but not limited to insertion of a mobile genetic element (e.g., a transposon); deletion of all or part of the gene, such that the gene product is not made, or is truncated and is non-functional; mutation of the gene such that the gene product is not made, or is truncated and is non-functional; deletion or mutation of one or more control elements that control expression of the gene such that the gene product is not made; and the like. In certain embodiments genes can be inactivated by methods other than genetic modification, for example, by gene silencing at the transcriptional level or at the post-transcriptional level using for example RNAi.
âRecombinant host cellâ refers to a cell into which has been introduced a heterologous polynucleotide, gene, promoter, e.g., an expression vector, or to a cell having a heterologous polynucleotide or gene integrated into the genome.
âNaturally-occurringâ or âwild-typeâ refers to the form found in nature. For example, a naturally occurring or wild-type polypeptide or polynucleotide sequence is a sequence present in an organism that can be isolated from a source in nature and which has not been intentionally modified by human manipulation. A wild-type organism refers to an organism that has not been intentionally modified by human manipulation.
As used herein the term âtransformedâ or âtransformationâ used in reference to a cell means a cell has a non-native nucleic acid sequence integrated into its genome or as a plasmid that is maintained through multiple generations.
As used herein the term âgeneâ refers to a polynucleotide (e.g., a DNA segment), that encodes a polypeptide and includes regions preceding and following the coding regions as well as intervening sequences (introns) between individual coding segments (exons).
Nucleic acids âhybridizeâ when they associate, typically in solution. There are numerous texts and other reference materials that provide details regarding hybridization methods for nucleic acids (See e.g., Tijssen, Laboratory Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Acid Probes.â Part 1, Chapter 2, Elsevier, New York, [1993], incorporated herein by reference). For polynucleotides of at least 100 nucleotides in length, low to very high stringency conditions are defined as follows: prehybridization and hybridization at 42° C. in 5ÃSSPE. 0.3% SDS, 200 μg/ml sheared and denatured salmon sperm DNA, and either 25% formamide for low stringencies, 35% formamide for medium and medium-high stringencies, or 50% formamide for high and very high stringencies, following standard Southern blotting procedures. For polynucleotides of at least 200 nucleotides in length, the carrier material is finally washed three times each for 15 minutes using 2ÃSSC, 0.2% SDS at least at 50° C. (âlowâ stringency), at least at 55° C. (âmediumâ or âmoderateâ stringency), at least at 60° C. (âmedium-highâ stringency), at least at 65° C. (âhighâ stringency), and at least at 70° C. (âvery highâ stringency). In some embodiments, the stringency conditions include those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ a denaturing agent during hybridization, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5ÃSSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5ÃDenhardt's solution, sonicated salmon sperm DNA (50 μg/mL), 0.1% SDS, and 10% dextran sulfate at 42° C., with washes at 42° C. in 0.2ÃSSC (sodium chloride/sodium citrate) and 50% formamide at 55° C., followed by a high-stringency wash consisting of 0.1ÃSSC containing EDTA at 55° C. In other embodiments, the stringency conditions include overnight incubation at 37° C. in a solution comprising: 20% formamide, 5ÃSSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5ÃDenhardt's solution, 10% dextran sulfate, and 20 mg/mL denatured sheared salmon sperm DNA, followed by washing the filters in 1ÃSSC at about 37-50° C. The skilled artisan will recognize how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors to accomplish the desired stringency.
As used herein, an âendogenousâ or âhomologousâ gene refers to a gene that is found in a parental strain of a cell (e.g., a bacterial cell). In some embodiments, endogenous genes are present in wild-type strains. As used herein in making comparisons between nucleic acid sequences, âhomologous genesâ (or âhomologueâ genes) refers to genes from different, but usually related species, that correspond to each other and are identical or very similar to each other. The term encompasses genes that are separated by speciation (i.e., the development of new species) (e.g., orthologous genes), as well as genes that have been separated by genetic duplication (e.g., paralogous genes).
As used herein, âheterologousâ polynucleotides are any polynucleotides that are introduced into a host cell through the use of laboratory techniques/manipulation, and include polynucleotides that are removed from a host cell, subjected to laboratory manipulation, and then reintroduced into a host cell.
As used herein, when used with reference to a nucleic acid or polypeptide, the term âheterologousâ refers to a sequence that is not normally expressed and secreted by an organism (e.g., a âwild-typeâ organism). In some embodiments, the term encompasses a sequence that comprises two or more subsequences which are not found in the same relationship to each other as normally found in nature, or is recombinantly engineered so that its level of expression, or physical relationship to other nucleic acids or other molecules in a cell, or structure, is not normally found in nature. For instance, a heterologous nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged in a manner not found in nature (e.g., a nucleic acid open reading frame (ORF) of the invention operatively linked to a promoter sequence inserted into an expression cassette, such as a vector).
As used herein, a âheterologous enzymeâ is used in reference to an enzyme that is encoded by a heterologous gene. However, it is also contemplated herein that a heterologous gene can encode an endogenous or homologous enzyme. As used herein, the term âheterologous geneâ refers to a gene that occurs in a form not found in a parental strain of the cell. Thus, in some embodiments, a heterologous gene is a gene that is derived from a species that is different from the species of the cell expressing the gene and recognized anamorphs, teleomorphs or taxonomic equivalents of the cell expressing the gene. In some embodiments, a heterologous gene is a modified version of a gene that is endogenous to the host cell (e.g., an endogenous gene subjected to manipulation and then introduced or transformed into the host cell). For example, in some embodiments, a heterologous gene has an endogenous coding sequence, but has modifications in the promoter sequence. Similarly, in other embodiments, a heterologous gene encodes the same amino acid sequence as an endogenous gene, but has modifications in codon usage and/or to noncoding regions (e.g., introns), and/or combinations thereof. For example, in some embodiments, a heterologous gene contains modifications to the coding sequence to encode a non-wild-type polypeptide. As another example, in some embodiments, a heterologous gene has the same promoter sequence, 5â² and 3â² untranslated regions and coding regions as a parental strain, but is located in another region of the same chromosome, or on an entirely different chromosome as compared to a parental strain of the host cell. In some embodiments, the heterologous gene is a gene that has been modified to overexpress a gene product of interest.
As used herein, ârecombinantâ includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid sequence or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found in identical form within the native (i.e., non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under-expressed or not expressed at all as a result of deliberate human intervention. âRecombinant,â âengineered.â and ânon-naturally occurring,â when used with reference to a cell, nucleic acid, or polypeptide, refers to a material, or a material corresponding to the natural or native form of the material, that has been modified in a manner that would not otherwise exist in nature, or is identical thereto but produced or derived from synthetic materials and/or by manipulation using recombinant techniques. Non-limiting examples include, among others, recombinant cells expressing genes that are not found within the native (i.e., non-recombinant) form of the cell or express native genes that are otherwise expressed at a different level. âRecombination,â ârecombining,â and âgenerating a recombinedâ nucleic acid also encompass the assembly of two or more nucleic acid fragments wherein the assembly gives rise to a chimeric gene.
As used herein, a âgenetically modifiedâ or âgenetically engineeredâ cell is a cell whose genetic material has been altered using genetic engineering techniques. A genetically modified cell also refers to a derivative of or the progeny of a cell whose genetic material has been altered using genetic engineering techniques. An example of a genetic modification as a result of genetic engineering techniques includes a modification to the genomic DNA. Another example of a genetic modification as a result of genetic engineering techniques includes introduction of a stable heterologous nucleic acid into the cell.
As used herein, the term âexpressionâ refers to the any step involved in the production of at least one polypeptide of interest, including but not limited to transcription and translation.
As used herein, the term âoverexpressionâ refers to any state in which a gene is caused to be expressed at an elevated rate or level as compared to the endogenous expression rate or level for that gene. In some embodiments, âoverexpressionâ includes an elevated translation rate or level of the gene compared to the endogenous translation rate or level for that gene. In some embodiments, overexpression includes an elevated transcription rate or level of the gene compared to the endogenous transcription rate or level for that gene. For example, in some embodiments, a heterologous gene is introduced into a cell to express a gene encoding a heterologous protein enzyme (e.g., beta-glucosidase or any other suitable enzyme or protein of interest) from another organism. In some other embodiments, a heterologous gene is introduced into a cell to overexpress a gene encoding a homologous enzyme such as a fatty alcohol reductase.
As used herein, the terms âamplificationâ and âgene amplificationâ refer to a method by which specific DNA sequences are disproportionately replicated such that the amplified gene becomes present in a higher copy number than was initially present in the genome. In some embodiments, selection of cells by growth in the presence of a drug (e.g., an inhibitor of an inhibitable enzyme) results in the amplification of either the endogenous gene encoding the gene product required for growth in the presence of the drug or by amplification of exogenous (i.e., input) sequences encoding this gene product, or both. âAmplificationâ is a special case of nucleic acid replication involving template specificity. It is to be contrasted with non-specific template replication (i.e., replication that is template-dependent but not dependent on a specific template). Template specificity is here distinguished from fidelity of replication (i.e., synthesis of the proper polynucleotide sequence) and nucleotide (ribo- or deoxyribo-) specificity. Template specificity is frequently described in terms of âtargetâ specificity. Target sequences are âtargetsâ in the sense that they are sought to be sorted out from other nucleic acid. Amplification techniques have been designed primarily for this sorting out.
As used herein, the term âprimerâ refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, that is capable of acting as a synthesis initiation point when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced (i.e., in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH). The primer is preferably single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products. In some embodiments, the primer is an oligodeoxyribonucleotide. The primer must be sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. As known in the art, the exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.
As used herein, the term âprobeâ refers to an oligonucleotide (i.e., a sequence of nucleotides), whether occurring naturally as in a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, that is capable of hybridizing to another oligonucleotide of interest. A probe may be single-stranded or double-stranded. Probes are useful in the detection, identification and isolation of particular gene sequences. It is contemplated that any probe used in the present invention will be labeled with any âreporter molecule,â so that is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA, as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. It is not intended that the present invention be limited to any particular detection system or label.
As used herein, the term âtarget,â when used in reference to the polymerase chain reaction, refers to the region of nucleic acid bounded by the primers used for polymerase chain reaction. Thus, the âtargetâ is sought to be sorted out from other nucleic acid sequences. A âsegmentâ is defined as a region of nucleic acid within the target sequence.
As used herein, the term âpolymerase chain reactionâ (PCR) refers to the methods of U.S. Pat. Nos. 4,683,195 4,683,202, and 4,965,188, hereby incorporated by reference, which include methods for increasing the concentration of a segment of a target sequence in a mixture of genomic DNA without cloning or purification. This method for amplifying the target sequence is well known in the art.
As used herein, the term âamplification reagentsâ refers to those reagents (deoxyribonucleotide triphosphates, buffer, etc.), needed for amplification except for primers, nucleic acid template and the amplification enzyme. Typically, amplification reagents along with other reaction components are placed and contained in a reaction vessel (test tube, microwell, etc.).
As used herein, the terms ârestriction endonucleasesâ and ârestriction enzymesâ refer to bacterial enzymes, each of which cut double-stranded DNA at or near a specific nucleotide sequence.
A ârestriction siteâ refers to a nucleotide sequence recognized and cleaved by a given restriction endonuclease and is frequently the site for insertion of DNA fragments. In some embodiments of the invention, restriction sites are engineered into the selective marker and into 5â² and 3â² ends of the DNA construct.
As used herein, âhomologous recombinationâ means the exchange of DNA fragments between two DNA molecules or paired chromosomes at the site of identical or nearly identical nucleotide sequences. In some embodiments, chromosomal integration is homologous recombination.
As used herein âamino acidâ refers to peptide or protein sequences or portions thereof. The terms âprotein,â âpeptide,â and âpolypeptideâ are used interchangeably in reference to a polymer of amino acid residues). The term âamino acidâ refers to naturally occurring and synthetic amino acids, as well as amino acid analogs. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified (e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine). âThe term amino acid analogsâ refers to compounds that have the same basic chemical structure as a naturally occurring amino acid (i.e., an α-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as homoserine, norleucine, methionine sulfoxide, or methionine methyl sulfonium). Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes. It is also understood that a polypeptide may be encoded by more than one nucleotide sequence, due to the degeneracy of the genetic code.
A used herein, an amino acid or nucleotide base âpositionâ is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5â²-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion. Where there is an insertion in an aligned reference sequence, that insertion will not correspond to a numbered amino acid position in the reference sequence. In the case of truncations or fusions there can be stretches of amino acids in either the reference or aligned sequence that do not correspond to any amino acid in the corresponding sequence.
As used herein, the terms ânumbered with reference toâ or âcorresponding to,â when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.
As used herein, âconservative substitution,â as used with respect to amino acids, refers to the substitution of an amino acid with a chemically similar amino acid. Amino acid substitutions that do not generally alter specific activity are well known in the art and are described in numerous textbooks.
The most commonly occurring exchanges are Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, and Asp/Gly, as well as these in reverse. In some embodiments herein, a conservative substitute for a residue is another residue in the same group as shown in the Table below.
basic amino acids arginine (R), lysine (K), histidine (H) acidic amino acids glutamic acid (E), aspartic acid (D) polar amino acids glutamine (Q), asparagine (N) hydrophobic amino acids leucine (L), isoleucine (I), valine (V) aromatic amino acids phenylalanine (F), tryptophan (W), tyrosine (Y) small amino acids glycine (G), alanine (A), serine (S), threonine (T), proline (P), cysteine (C), methionine (M)
In some embodiments, âconservativeâ amino acid substitutions or mutations refer to the interchangeability of residues having similar side chains, and thus typically involves substitution of the amino acid in the polypeptide with amino acids within the same or similar defined class of amino acids. However, as used herein, conservative mutations do not include substitutions from a hydrophilic to hydrophilic, hydrophobic to hydrophobic, hydroxyl-containing to hydroxyl-containing, or small to small residue, if the conservative mutation can instead be a substitution from an aliphatic to an aliphatic, non-polar to non-polar, polar to polar, acidic to acidic, basic to basic, aromatic to aromatic, or constrained to constrained residue. Further, as used herein. A, V, L, or I can be conservatively mutated to either another aliphatic residue or to another non-polar residue. The following table provides exemplary conservative substitutions.
Residue Possible Conservative Mutations A, L, V, I Other aliphatic (A, L, V, I) Other non-polar (A, L, V, I, G, M) G, M Other non-polar (A, L, V, I, G, M) D, E Other acidic (D, E) K, R Other basic (K, R) P, H Other constrained (P, H) N, Q, S, T Other polar (N, Q, S, T) Y, W, F Other aromatic (Y, W, F) C None
âNon-conservative substitutionâ refers to substitution or mutation of an amino acid in the polypeptide with an amino acid with significantly differing side chain properties. Non-conservative substitutions may use amino acids between, rather than within, the defined groups listed above. In one embodiment, a non-conservative mutation affects (a) the structure of the peptide backbone in the area of the substitution (e.g., proline for glycine) (b) the charge or hydrophobicity, or (c) the bulk of the side chain.
The following nomenclature may be used to describe substitutions in a reference sequence relative to a reference sequence or a variant polypeptide or nucleic acid sequence: âR-#-V,â where â#â refers to the position in the reference sequence, âRâ refers to the amino acid (or base) at that position in the reference sequence, and âVâ refers to the amino acid (or base) at that position in the variant sequence.
The term âamino acid substitution setâ or âsubstitution setâ refers to a group of amino acid substitutions. A substitution set can have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more amino acid substitutions.
As used herein, âdeletionâ when used in reference to a polypeptide, refers to modification of the polypeptide by removal of one or more amino acids from a reference polypeptide. Deletions can comprise removal of 1 or more amino acids, 2 or more amino acids, 3 or more amino acids, 4 or more amino acids, 5 or more amino acids, 6 or more amino acids, 7 or more amino acids, 8 or more amino acids, 9 or more amino acids, 10 or more amino acids, 15 or more amino acids, or 20 or more amino acids, up to 10% of the total number of amino acids, or up to 20% of the total number of amino acids making up the polypeptide while retaining enzymatic activity and/or retaining the improved properties of an engineered at least one protease enzyme. Deletions may be present in the internal portions and/or terminal portions of the polypeptide. In some embodiments, the deletion comprises a continuous segment, while in other embodiments, it is discontinuous.
As used herein, a âgene deletionâ or âdeletion mutationâ is a mutation in which at least part of a sequence of the DNA making up the gene is missing. Thus, a âdeletionâ in reference to nucleic acids is a loss or replacement of genetic material resulting in a complete or partial disruption of the sequence of the DNA making up the gene, including its regulatory sequences involved in DNA transcription and RNA translation. Any number of nucleotides can be deleted, from a single base to an entire piece of a chromosome. Thus, in some embodiments, the term âdeletionâ refers to the removal of a gene necessary for encoding a specific protein (e.g., a protease). In this case, the strain having this deletion can be referred to as a âdeletion strain.â
âInsertionâ refers to modification to the polypeptide by addition of one or more amino acids to the reference polypeptide. In some embodiments, the modification comprises insertions of one or more amino acids to the naturally occurring polypeptide as well as insertions of one or more amino acids to other modified polypeptides. Insertions can be in the internal portions of the polypeptide, or to the carboxy or amino terminus. Insertions as used herein include fusion proteins as is known in the art. The insertion can be a contiguous segment of amino acids or separated by one or more of the amino acids in the naturally occurring polypeptide. The term âinsertionâ is also used to refer to a DNA modification in which or more nucleotides or nucleotide base-pairs have been inserted, as compared to the corresponding reference, parental or âwild typeâ DNA.
As used herein, the phrases âdifferent fromâ and âdiffers fromâ when used with respect to a designated reference sequence refers to difference of a given amino acid or polynucleotide sequence when aligned to the reference sequence. Generally, the differences can be determined when the two sequences are optimally aligned. Differences include insertions, deletions, or substitutions of amino acid residues in comparison to the reference sequence.
As used herein in the context of a polypeptide or polynucleotide, the phrase âderived fromâ a particular organism refers to a wild-type polynucleotide or polypeptide that originates in the organism and to mutant and variants thereof that either originate in the organism or are produced by human manipulation of the wild-type polynucleotide or polypeptide.
âFunctional fragmentâ as used herein refers to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion, but where the remaining amino acid sequence is identical to the corresponding positions in the sequence and that retains substantially all of the activity of the full-length polypeptide. Functional fragments can comprise up to about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% of the full-length polypeptide.
âPercentage of sequence identity,â âpercent identityâ and âpercentage homologyâ are used interchangeably herein to refer to comparisons among polynucleotides and polypeptides, and are determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which may also contain gaps to optimize the alignment) for alignment of the two sequences. The percentage may be calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (including positions where one of the sequences has a gap) and multiplying the result by 100 to yield the percentage of sequence identity. Alternatively, the percentage may be calculated by determining the number of positions at which either the identical nucleic acid base or amino acid residue occurs in both sequences or a nucleic acid base or amino acid residue is aligned with a gap to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. Those of skill in the art appreciate that there are many established algorithms available to align two sequences and that different methods may give slightly different results.
Alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (See, Smith and Waterman, Adv. Appl. Math., 2:482 [1981]), by the homology alignment algorithm of Needleman and Wunsch, (See, Needleman and Wunsch, J. Mol. Biol., 48:443 [1970]), by the search for similarity method of Pearson and Lipman (See, Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 [1988]), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the GCG Wisconsin Software Package), or by visual inspection, using methods known in the art. In some embodiments, the Clustal (See, Chenna et al., Nucl. Acids Res., 31:3497-3500 [2003]) and T-Coffee (See, Notredame et al., J. Mol. Biol., 302:205-217 [2000]) software packages find use in aligning sequences.
Examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms (See e.g., Altschul et al., J. Mol. Biol., 215:403-410 [1990]; and Altschul et al., Nucl. Acids Res., 25:3389-3402 [1977], respectively). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information website. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as, the neighborhood word score threshold (See, Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues: always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value: the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments: or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=â4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (See, Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 [1989]). Exemplary determination of sequence alignment and % sequence identity can employ the BESTFIT or GAP programs in the GCG Wisconsin Software package (Accelrys, Madison Wis.), using default parameters provided.
âReference sequenceâ refers to a defined sequence used as a basis for a sequence comparison. A reference sequence may be a subset of a larger sequence, for example, a segment of a full-length gene or polypeptide sequence. Generally, a reference sequence is at least 20 nucleotide or amino acid residues in length, at least 25 residues in length, at least 50 residues in length, or the full length of the nucleic acid or polypeptide. Since two polynucleotides or polypeptides may each (1) comprise a sequence (i.e., a portion of the complete sequence) that is similar between the two sequences, and (2) may further comprise a sequence that is divergent between the two sequences, sequence comparisons between two (or more) polynucleotides or polypeptide are typically performed by comparing sequences of the two polynucleotides over a âcomparison windowâ to identify and compare local regions of sequence similarity.
âComparison windowâ refers to a conceptual segment of at least about 20 contiguous nucleotide positions or amino acids residues wherein a sequence may be compared to a reference sequence of at least 20 contiguous nucleotides or amino acids and wherein the portion of the sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The comparison window can be longer than 20 contiguous residues, and includes, optionally 30, 40, 50, 100, or longer windows.
As used herein, âsubstrateâ refers to a substance or compound that is converted or designated for conversion into another compound (e.g., a product) by the action of an enzyme. The term includes not only a single compound but also combinations of compounds, such as solutions, mixtures and other materials which contain at least one substrate.
As used herein, âconversionâ refers to the enzymatic transformation of a substrate to the corresponding product. âPercent conversionâ refers to the percent of the substrate that is converted to the product within a period of time under specified conditions. Thus, the âenzymatic activityâ or âactivityâ of a polypeptide can be expressed as âpercent conversionâ of the substrate to the product.
As used herein, âculturingâ and âcultivationâ refer to growing a population of microbial cells under suitable conditions in a liquid, solid or semi-solid medium. In some embodiments, culturing refers to the fermentative bioconversion of a substrate to an end-product. Culturing media are well known and individual components of such culture media are available from various commercial sources (e.g., Difco® and BBL® media). In one non-limiting example, the aqueous nutrient medium is a ârich mediumâ comprising complex sources of nitrogen, salts, and carbo, such as YP medium, comprising 10 g/L of peptone and 10 g/L yeast extract of such a medium.
In some embodiments, cells are grown under batch or continuous fermentations conditions.
âContinuous culturingâ is an open system in which a culture medium (typically, a defined culture medium) is added continuously to a bioreactor and an equal amount of conditioned medium is removed simultaneously for processing. Continuous culturing generally maintains the cultures at a constant high density where cells are primarily in log phase growth. Continuous culturing systems strive to maintain steady state growth conditions. Methods for modulating nutrients and growth factors for continuous culturing processes as well as techniques for maximizing the rate of product formation are well known in the art of industrial microbiology.
Combinations and/or variations of unique characteristics of these processes find use in various embodiments of the present invention. Indeed, it is not intended that the present invention be limited to any specific growth protocol and/or method. Classical âbatch culturingâ involves a closed system, wherein the composition of the medium is set at the beginning of the culture process and is not subject to artificial alternations during the culture process. A variation of the batch system is âfed-batch culturingâ which also finds use in the present invention. In this variation, the substrate is added in increments as the culturing process progresses. Fed-batch systems are useful when catabolite repression is likely to inhibit the metabolism of the cells and where it is desirable to have limited amounts of substrate in the medium. Batch and fed-batch cultures are common and well known in the art. In some additional embodiments, ârepeated fed-batchâ culturing finds use in the present invention. In these methods, the feed (i.e., comprising at least one carbon source) is added in increments as the culturing process progresses. When the broth volume reaches a predefined working volume of the culture vessel, a portion of the broth is removed, generating new vessel capacity to accommodate further carbon source feeding. The repeated fed-batch systems are useful to maximize culture vessel capacity and enable the production of more total product than the standard fed-batch process.
As used herein, âfed-batch methodâ refers to a method by which a fed-batch culture or repeated fed-batch culture is supplied with additional nutrients. For example, in some embodiments, fed-batch methods (including repeated fed-batch methods) comprise adding supplemental media according to a determined feeding schedule within a given time period.
In some embodiments, fermentations are carried out a temperature within the range of from about 10° C. to about 60° C., from about 15° C. to about 50° C., from about 20° C. to about 45° C., and from about 25° C. to about 40° C. In some embodiments, the fermentation is carried out at a temperature of from about 28° C. and also from about 30° C. In some other embodiments, the fermentation is carried out for a period of time within the range of from about 8 hours to 240 hours, from about 8 hours to about 168 hours, from about 16 hours to about 144 hours, from about 16 hours to about 120 hours, or from about 24 hours to about 72 hours. It will be understood that, in certain embodiments where thermostable host cells are used, fermentations may be carried out at higher temperatures. In other embodiments, the fermentation will be carried out at a pH in the range of 4 to 8, in the range of 4.5 to 7.5, in the range of 5 to 7, and also in the range of 5.5 to 6.5.
Carbon sources useful in the aqueous fermentation medium or broth of the disclosed process in which the recombinant microorganisms are grown are those assimilable by the recombinant host strain. Assimilable carbon sources are available in many forms and include renewable carbon sources and the cellulosic and starch feedstock substrates obtained there from. Such examples include for example monosaccharides, disaccharides, oligosaccharides, saturated and unsaturated fatty acids, succinate, acetate and mixtures thereof. Further carbon sources include, without limitation, glucose, galactose, sucrose, xylose, fructose, glycerol, arabinose, mannose, raffinose, lactose, maltose, and mixtures thereof. In some embodiments, the term âfermentable sugarsâ is used interchangeably with the term âassimilable carbon source.â In some embodiments, fermentation is carried out with a mixture of glucose and galactose as the assimilable carbon source. In another aspect, fermentation is carried out with glucose alone to accumulate biomass, after which the glucose is substantially removed and replaced with an inducer (e.g., galactose for induction of expression of one or more heterologous genes involved in fatty alcohol production). In some other embodiments, fermentation is carried out with an assimilable carbon source that does not mediate glucose repression (e.g., raffinose), to accumulate biomass, after which the inducer (e.g., galactose), is added to induce expression of one or more heterologous genes involved in fatty alcohol production. In some embodiments, the assimilable carbon source is from cellulosic and starch feedstock derived from but not limited to, wood, wood pulp, paper pulp, grain, corn stover, corn fiber, rice, paper and pulp processing waste, woody or herbaceous plants, fruit or vegetable pulp, distillers grain, grasses, rice hulls, wheat straw, cotton, hemp, flax, sisal, corn cobs, sugar cane bagasse, switch grass and mixtures thereof.
As used herein, the term âinducerâ refers to any molecule or compound that positively influences the over-production of any protein (e.g., enzyme) over the corresponding basal level of production.
As used herein, the term âinducer-freeâ media refers to media that lack any inducer molecule or compound, while the term âinducer-containingâ media refers to media that comprise one or more inducers.
As used herein, the term âalcoholâ refers to any compound comprising at least hydroxyl group. In some embodiments, the term encompasses compounds comprising carbon chain lengths of about one to about twenty. In some additional embodiments, the term encompasses compounds comprising carbon lengths greater than twenty. In some further embodiments, the term encompasses, but is not limited to ethanol, methanol, butanol, proponal, fatty alcohols, etc. Indeed, it is intended that the term encompass any compound comprising at least one hydroxyl group, including but not limited to compounds that comprise other constituents.
The foregoing and other aspects of the invention may be better understood in connection with the following non-limiting examples.
EXPERIMENTAL
The present invention is described in further detail in the following Examples, which are not in any way intended to limit the scope of the invention as claimed.
In the experimental disclosure below, the following abbreviations apply: ppm (parts per million); M (molar); mM and mmol (millimolar), uM and μM (micromolar); nM (nanomolar); mol (moles); gm and g (gram); mg (milligrams); ug and μg (micrograms); L and l (liter); ml and mL (milliliter); cm (centimeters); mm (millimeters); um and μm (micrometers); sec. (seconds); min(s) (minute(s)); h(s) and hr(s) (hour(s)); U (units); slp (standard liters per minute); MW (molecular weight): rpm (rotations per minute); ° C. (degrees Centigrade); OD (optical density); DNA (deoxyribonucleic acid): RNA (ribonucleic acid): FAR (fatty alcohol reductase); GC-FID (gas chromatography-flame ionization detector); GC-MS (gas chromatography-mass spectroscopy); HPLC (high pressure liquid chromatography); MIBK (methyl isobutyl ketone); PHUSION® (PHUSION® is a registered trademark of Thermo Fisher Scientific. Inc., Waltham, Mass.); Thermo Scientific (Thermo Scientific, Wilmington, Del.); BDH (BDH Chemicals, available from VWR International, LLC, Radnor, Pa.); Roche (Roche Applied Science, Pleasanton, Calif.); FIOPC (fold improvements over positive control); ARS (ARS Culture Collection or NRRL Culture Collection, Peoria, Ill.); ATCC (American Type Culture Collection, Manassas, Va.); ADM (Archer Daniels Midland. Decatur, Ill.); Axygen (Axygen, Inc., Union City, Calif.); GenScript (GenScript, USA Inc., Piscataway, N.J.); CGSC (E. coli Genetic Stock Center, Yale University, New Haven, Conn.); HERCULASE® is a registered trademark of Agilent Technologies (Agilent Technologies. Santa Clara, Calif.); (Dual Biosystems (Dual Biosystems AG, Schlieven, Switzerland); Megazyme (Megazyme International Ireland, Ltd., Wicklow, Ireland); Sigma-Aldrich (Sigma-Aldrich, St. Louis, Mo.); BASF (BASF Aktiengesellschaft Corp., Ludwigshafen, Del.); Dasgip (Dasgip Biotools. LLC, Shrewsbury, Mass.); Difco (Difco Laboratories, BD Diagnostic Systems, Detroit, Mich.); PCRdiagnostics (PCRdiagnostics, by E coli SRO, Slovak Republic); Agilent (Agilent Technologies, Inc., Santa Clara, Calif.); Molecular Devices (Molecular Devices, Sunnyvale, Calif.); Symbio (Symbio, Inc., Menlo Park, Calif.); Newport (Newport Scientific. Australia); Bio-Rad (Bio-Rad Laboratories, Hercules, Calif.); Qiagen (Qiagen Sciences Inc., Germantown, Mass.); Zymo (Zymo Research Corporation. Irvine, Calif.); Promega (Promega Corporation, Madison, Wis.); Invitrogen (Invitrogen, Inc., Carlsbad, Calif.); NEB (New England BioLabs, Ipswich, Mass.); Sensient (Sensient Bio-Ingredients, Indianapolis, Ind.); Alfa Aesar (Alfa Aesar, Ward Hill, Mass.); Calbiochem (EMD Biosciences Inc., San Diego, Calif.); Mallinckrodt (Mallinckrodt Baker Inc. St. Louis, Mo., now Avantor Performance Materials, Center Valley, Pa.); JT Baker Mallinckrodt Baker Inc., St. Louis, Mo., now Avantor Performance Materials, Center Valley, Pa.); (Corn Products (Corn Products International, Stockton, Calif.); Richman Chemical (Richman Chemical Inc., Lower Gwynedd, Pa.); Omnipur (Omnipur, Caldwell, Id.; available from EMD Biosciences Inc., San Diego, Calif.); AMRESCO (AMRESCO LLC, Solon, Ohio); Michrom (Michrom Bioresources, Inc., Auburn, Calif.); LB (Luria-Bertani); LA (Luria-Bertani Agar); SOC (Super Optimal broth with Catabolite repression); and TB (Terrific Broth).
One method for quantification of total fatty alcohols and each one of the different chain lengths used cells were collected by centrifugation for 10 minutes at 6000 rpm in F15B-8Ã50C rotor. The cell pellets were resuspended in 0.5 mL of 6.7% Na2SO4 and then extracted with 1 mL of isopropanol:methyl t-butyl ether (4/6 ratio) for 2 hrs. The extract was centrifuged and analyzed either directly by GC-FID or GC-MS or derivatized with BSTFA before analysis. For derivatization, a 400 μL sample was taken off the top organic layer, evaporated under a nitrogen stream and the residue was derivatized with 100 μL N,O-Bis(trimethylsilyl)trifluoroacetamide) (BSTFA) at 37° C. for 1 hour, and then diluted with 100 μL of heptanes before analysis by GC-FID or GC-MS. 0.5 mL of the culture medium (after removal of cells by centrifugation) was also extracted with 1 mL methyl t-butyl ether for 1 hr. The organic phase was either analyzed directly by GC-FID or GC-MS or derivatized with BSTFA as described above before analysis. In addition, 0.5 mL of the cell culture (before removal of cells by centrifugation) was directly extracted with 1 mL of isopropanol:hexane (4:6 ratio) for 2 hrs. The organic phase was either analyzed directly by GC-FID or GC-MS or derivatized with BSTFA as described above before analysis.
A 1 μL sample was analyzed by GC-FID with the split ratio 1:10 using the following conditions: GC-6890N from Agilent Technologies equipped with FID detector and HP-5 column (length 30 m, I.D. 0.32 mm, film 0.25 um). GC method: start at 100° C., increase the temperature with a rate of 25° C./min to 246° C. and hold for 1.96 min. Total run time, 7.8 min. Under the above GC conditions the approximate retention times (min) of produced fatty alcohols and acids are as follows: 5.08, C14:0-OH: 5.40; C14:0-OOH; 5.74, C16:1-OH; 5.93, C16:0-OH; 6.11, C16:0-OOMe (internal standard); 6.16, C16:1-OOH; 6.29. C16:0-OOH; 6.80, C18:1-OH; 6.90, C18:0-OH; 7.3, C18:0- and C18:1-OOH. Identification of individual fatty alcohol was done by comparison to commercial standards (Sigma).
Example 1 Design and Cloning of the Synthetic Promoter Pho1
This Example describes the design and cloning of an E. coli synthetic promoter containing two PhoB-binding sites (PhoB boxes). In this construct, one of these PhoB boxes overlaps with the â35 region of the promoter, this PhoB box is referred to herein as the âPho1 promoter.â Other features included of this design included: an upstream transcriptional terminator to isolate the promoter from transcription of upstream promoter(s); consensus â35 and â10 regions to enhance RNA polymerase binding; 27 bp derived from P1 promoter from the rrnB gene to facilitate transcription initiation; 71 bp derived from rrnB gene, containing the anti-termination signals; 73 bp containing signals to enhance message RNA translation: and regions of homology to the lacI-LacZ genes.
The nucleotide sequence of the synthetic promoter's DNA is provided below:
CCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGC AATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCC CAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGC TGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTAATAAAAATGCCAG CCGATCGGGCTGGCATTTTTGCCTTTAAATTGGTTTGACAGCTTATCATC GACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTG TGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAG GCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATGTTTGTGACAG ATATATGACAGGAATTTGACAGATATATGACAGGCTGGTATAATGCGCCA CCACTGACACGGAACAACGGCGCGCCGCTGAGAAAAAGCGAAGCGGCACT GCTCTTTAACAATTTATCAGACAATCTGTGTGGGCACTCGACCGGAATTA TCGATTAACTTTATTATTAAAAATTAAAGAGGTATATATTAATGTATCGA TTAAATAAGGAGGAATAAACCATGACCATGATTACGGATTCACTGGCCGT CGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATC GCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCC CGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCG CTTTGCCTGGTTTCCGGC
This synthetic DNA was synthesized and cloned by GenScript in a pJETI-2 plasmid into the EcoRV site.
Example 2 Construction of a DNAS Cassette to Control fabB with the Pho1 Promoter
This Example describes the construction of a DNAS cassette to control fabB with the Pho1 promoter. This promoter cassette was designed to modulate the expression level of fabB based on the phosphate levels in the media by replacing the fabB native regulatory region with the kanamycin-Pho1 promoter cassette. This cassette contained 40 bp and 31 bp of regions of homology to the E. coli fabB gene, as well as the Pho1 promoter and a kanamycin resistance gene flanked by FLP recombinase target sites (âFRT sitesâ) as shown in FIG. 2 . The presence of the FRT sites facilitates removal of the Km marker by the action of the FLP recombinase.
This cassette was assembled by PCR in 3 steps using the Pho1-promoter cloned in pJETI described in Example 1. The following primers and conditions were used to obtain this cassette.
In the first step, the forward oligo (5â² CDX-Pho1 F) (SEQ ID NO:9) containing 33 bases of homology to the kanamycin cassette (including an FRT site) and the reverse oligo (3â² CDX Pho R) (SEQ ID NO:10) containing 40 bases of homology to the native fabB ribosome binding site RBS and 5â² sequence of the FabB chromosomal gene were used. The sequences are shown below. The expected PCR product was 340 base pairs in length.
AGT ATA GGA ACT TCG AAG CAG CTC CAG CCT ACA AAT AAA AAT GCC AGC CGA TCG GGC TGG 3â²âCDX Pho R: TCA TTC AAT ACC TCT GTA AGT CGC ACA TAG AGT AAG TTT CTG GTG GCG CAT TAT ACC AGC
The PCR protocol used:
Template (10 ng/μl) 1 μl 5x HT PHUSIONâ® Buffer 10 μl â 10 mM dNTPs 1 μl DMSO 2 μl Forward Oligo 20 μM 1 μl Reverse Oligo 20 μM 1 μl PHUSIONâ® Polymerase (2 U/μl) 0.5 μlââ H2O 33.5 μlââ Total volume: 50 μlâ
The PCR conditions utilized were 1 cycle of 98° C. for 2 minutes, followed by 30 cycles of 98° C. for 10 seconds, 60° C. for 15 seconds, and 72° C. for 20 seconds, followed by a final cycle of 72° C. for 2 minutes.
In the second step, the kanamycin cassette was PCR amplified from pKD13 plasmid using the following primers. The forward oligo (5â² Kan F) (SEQ ID NO:11) contains 35 bases of homology to sequence upstream of the integration site and the Reverse oligo (3â² Kan R) (SEQ ID NO:12) contains 35 bases of homology to the 5â² sequence of Pho1. The expected PCR product was 1380 base pairs in length.
AGG CGG TGG CTC GAT CTT AGC GAT GTG TGT AAG GCT GCG CAT TCC GGG GAT CCG TCG ACC 3â²âKan R: AAA GGC AAA AAT GCC AGC CCG ATC GGC TGG CAT TTT TAT TTG TAG GCT GGA GCT GCT TCG
The PCR protocol utilized:
Template (10 ng/μl) 1 μl 5x HF PHUSIONâ® Buffer 10 μl â 10 mM dNTPs 1 μl DMSO 2 μl Forward Oligo 20 μM 1 μl Reverse Oligo 20 μM 1 μl PHUSIONâ® Polymerase (2 U/μl) 0.5 μlââ H2O 33.5 μlââ Total volume: 50 μlâ
The PCR conditions utilized were 1 cycle of 98° C. for 2 minutes, followed by 30 cycles of 98° C. for 10 seconds, 60° C. for 15 seconds and 72° C. for 45 seconds, followed by a final cycle of 72° C. for 2 minutes.
In step 3, both PCR products from the previous two steps were gel purified and used as template to assemble the final integration cassette using the following oligos in splice overlap and extension PCR (SOE). The final cassette was 1650 base pairs in length.
AGG CGG TGG CTC GAT CTT AGC GAT GTG TGT AAG GCT GCG CAT TCC GGG GAT CCG TCG ACC 3â²âCDX Pho R: TCA TTC AAT ACC TCT GTA AGT CGC ACA TAG AGT AAG TTT CTG GTG GCG CAT TAT ACC AGC
The PCR protocol utilized:
Template (10 ng of each PCR product) 1 μl 5x HF PHUSIONâ® Buffer 10 μl â 10 mM dNTPs 1 μl DMSO 2 μl Forward Oligo 20 μM 1 μl Reverse Oligo 20 μM 1 μl PHUSIONâ® Polymerase (2 U/μl) 0.5 μlââ H2O 33.5 μlââ Total volume: 50 μlâ
The PCR conditions utilized were 1 cycle of 98° C. for 2 minutes, followed by 30 cycles of 98° C. for 10 seconds, 65° C. for 15 seconds, and 72° C. for 1 minute, followed by a final cycle of 72° C. for 2 minutes. After this reaction, the PCR product was purified and desalted through a PCR purification column (Qiagen) and eluted with water.
The DNA sequence of the final cassette is shown below. The regions of homology with the chromosome are shown in bold:
AGGCGGTGGCTCGATCTTAGCGATGTGTGTAAGGCTGCGCATTCCGGGGA TCCGTCGACCTGCAGTTCGAAGTTCCTATTCTCTAGAAAGTATAGGAACT TCAGAGCGCTTTTGAAGCTCACGCTGCCGCAAGCACTCAGGGCGCAAGGG CTGCTAAAGGAAGCGGAACACGTAGAAAGCCAGTCCGCAGAAACGGTGCT GACCCCGGATGAATGTCAGCTACTGGGCTATCTGGACAAGGGAAAACGCA AGCGCAAAGAGAAAGCAGGTAGCTTGCAGTGGGCTTACATGGCGATAGCT AGACTGGGCGGTTTTATGGACAGCAAGCGAACCGGAATTGCCAGCTGGGG CGCCCTCTGGTAAGGTTGGGAAGCCCTGCAAAGTAAACTGGATGGCTTTC TTGCCGCCAAGGATCTGATGGCGCAGGGGATCAAGATCTGATCAAGAGAC AGGATGAGGATCGTTTCGCATGATTGAACAAGATGGATTGCACGCAGGTT CTCCGGCCGCTTGGGTGGAGAGGCTATTCGGCTATGACTGGGCACAACAG ACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAGGGGCG CCCGGTTCTTTTTGTCAAGACCGACCTGTCCGGTGCCCTGAATGAACTGC AGGACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCGTTCCTTGC GCAGCTGTGCTCGACGTTGTCACTGAAGCGGGAAGGGACTGGCTGCTATT GGGCGAAGTGCCGGGGCAGGATCTCCTGTCATCTCACCTTGCTCCTGCCG AGAAAGTATCCATCATGGCTGATGCAATGCGGCGGCTGCATACGCTTGAT CCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGCGAGC ACGTACTCGGATGGAAGCCGGTCTTGTCGATCAGGATGATCTGGACGAAG AGCATCAGGGGCTCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGCGCGC ATGCCCGACGGCGAGGATCTCGTCGTGACCCATGGCGATGCCTGCTTGCC GAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGTGGCC GGCTGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCCGTGAT ATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTA CGGTATCGCCGCTCCCGATTCGCAGCGCATCGCCTTCTATCGCCTTCTTG ACGAGTTCTTCTAATAAGGGGATCTTGAAGTTCCTATTCCGAAGTTCCTA TTCTCTAGAAAGTATAGGAACTTCGAAGCAGCTCCAGCCTACAAATAAAA ATGCCAGCCGATCGGGCTGGCATTTTTGCCTTTAAATTGGTTTGACAGCT TATCATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCG GAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTC GCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATGTTT GTGACAGATATATGACAGGAATTTGACAGATATATGACAGGCTGGTATAA TGCGCCACCAGAAACTTACTCTATGTGCGACTTACAGAGGT Example 3 Construction of a Strain with fabB Under Control of the Pho1 Promoter
This Example describes the construction of an E. coli strain with fabB under control of the Pho1 promoter. In this construct, the cassette described in Example 2 was used to replace the native regulatory region of the FabB gene in the chromosome of the E. coli strain W3110K (CGSC), as described below.
First, recombinase-induced cells were prepared. A single colony of strain W3110K containing plasmid pSIM5 (See, Datta et al., Gene 379:109-115 [2006]) was used to inoculate a 3 ml of LB media (Difco)+30 μg/mL chloramphenicol and cultivated overnight) at 30° C. 350 μL of this overnight culture were added to 40 ml of TB media (Difco)+30 μg/mL chloramphenicol (pre-warmed to 30° C.) in a 250 ml baffled Erlenmeyer flask. The cells were grown at 30° C. with shaking at 250 rpm for 2 hours and 45 minutes (ËOD600 of 0.5). The flask was immediately transferred to a 42° C. water bath, and incubated with shaking at 300 rpm for 12 minutes (this step ensures that the recombinase has been induced). Immediately after induction, the culture was rapidly chilled in ice-water and left on ice for 5-10 min. The induced culture was transferred to a pre-chilled centrifuge tube and centrifuged for 10 min at Ë4000Ãg at 4° C. The supernatant was aspirated and 1 ml of ice-cold sterile distilled H2O was added to the cell pellet to resuspend the cells after which, another 40 ml of ice-cold distilled H2O was added. The tube was centrifuged again as in the previous step (i.e., 10 min at Ë4000Ãg at 4° C.). The resulting 40 ml supernatant was decanted and the pellet was resuspended in 1 ml ice-cold distilled H2O. The cells were transferred to a pre-chilled microcentrifuge tube and centrifuged for 1 min at Ë10,000Ãg in a 4° C. refrigerated microcentrifuge. The supernatant was aspirated and the wash step was repeated one more time. The resulting cell pellet was resuspended in Ë250 μl of sterile ice-cold distilled H2O and kept on ice until used.
Then, electrotransformation of linear PCR product into the recombinase-induced cells was performed by pipetting 1 to 10 μl (Ë100 ng) of salt-free PCR fragment into 50 μl of electrocompetent cells prepared in step 1. The cells and DNA mixture were transferred to a 1 mm cuvette on ice and electroporated at 1.7 kV. Immediately after electrotransformation, the cells were resuspended in 2 mL of SOC media (Invitrogen) in a new, sterile culture tube. The tubes were then incubated at 37° C. for Ë3 hours to allow completion of recombination and expression of the drug-resistance gene.
Following incubation, the cells were selected for positive integrants. In this process, 100 μl of the culture obtained after the Ë3 hours incubation described above, was plated onto agar plates with 20 g/mL kanamycin. Additionally, 1 mL of cells were spun down, resuspended in 100 μl of LB and plated on LA (Difco) plates with 40 μg/mL kanamycin. The plates were incubated at 37° C. overnight. Approximately Ë20 colonies per 100 μl of culture were observed.
Following incubation, confirmation of the proper genomic modification was conducted. In this step, colonies from the above plates were streaked out onto non-selective LB plates to produce single colonies. Twelve (12) colonies from the non-selective plates were verified by PCR and sequencing. Two synthetic oligos were used to amplify the fabB regulatory region (FB genome-up and FB genome-down, as shown below). These oligos are located approximately 250 bases upstream or downstream of the modified region in the chromosome. The expected size of this PCR product was 3227 bp.
TTG GAA AAA TAG ACA TCG TCA AAA TCT C FB genome-down: TGC AGC GCA AGG CGA GGA GTA TCC CCG TCT
The PCR protocol utilized:
Template (colony dissolved in H2O) â1 μl 5x HERCULASEâ® II Reaction Buffer 10 μl 10 mM dNTPs â1 μl Betaine 5M 10 μl Forward Oligo 20 μM â1 μl Reverse Oligo 20 μM â1 μl HERCULASEâ® II Fusion DNA Polymerase 0.5 μlâ (2 U/μl) H2O 25.5 μlââ Total volume: 50 μl
The PCR conditions utilized were 1 cycle of 95° C. for 2 minutes, followed by 30 cycles of 95° C. for 20 seconds, 60° C. for 30 seconds, and 72° C. for 3 minutes, followed by a final cycle of 72° C. for 2 minutes.
The obtained PCR products were fully sequenced using the following primers:
ATT CCG GGG ATC CGT CGA CC Kan 5â²âF2: GGC ACA ACA GAC AAT CGG CT Kan 5â²âF3: CCT GCT TGC CGA ATA TCA TG CDXPho Seq F1: GCC TTT AAA TTG GTT TGA CAG CT FabB seqF1: CGT GCA GTG ATT ACT GGC CTG FabB seqF2: ATG TGG TCA CCA AAG CGA TG FabB seqF3: GGT ACT TCG ACT CCG GTT GG FabB seqF4: CTG GTA ATG CGC AAG CTG AA FabB seqR1: AAT GCC CAG GCC AGT AAT C CdxPho1 seq R1: TAT CTG TCA CAA ACA TGT CG Example 4 FabB mRNA Analysis by qPCR
In this Example, experiments conducted using qPCR to quantify the levels of fabB mRNA produced by the strains produced in Example 3 are described. In these experiments, the materials included the RNeasy Mini Kit (Qiagen), RNAprotect Bacterial Reagent (Qiagen), mercaptoethanol, ethanol, lysozyme (Sigma), proteinase K (Qiagen), RNAse-Free DNase Set (Qiagen), Zymo-RNA clean and concentrator-5 (Zymo), ImProm-II Reverse Transcription System (Promega), LightCycler 480 SYBR Green Master Mix (Roche), and qPCR primers.
In this protocol, RNA was prepared by adding a sample of culture directly to a tube with 2 volumes RNAprotect bacterial reagent. The contents were mixed and incubated at RT for 5 min. Typically, at an induction OD of Ë0.5-0.8, an aliquot of approximately 1-1.5 mL was taken and Ë0.25-0.4 mL were sampled at later time points. Each sample was centrifuged for 10 min at 5000Ãg and the supernatant was decanted. At this point were frozen at â80 or used directly in the RNeasy Mini Kit.
First, the RNA was prepared as directed in Protocol 4 of the RNeasy manual (enzymatic lysis and proteinase K digestion of bacteria). The RNA was quantitated using a Nanodrop 2000 instrument (Thermo). Next, the DNase 1 stock solution was prepared by dissolving the solid powder in 550 uL water by gentle mixing and distributed into 50 uL aliquots which were stored at â20° C. until use. The DNase reaction utilized â¦5 ug RNA, 3 uL RDD buffer, 1 uL DNase 1, and sufficient water to provide 30 uL of solution. The solution was incubated at 37° C. for 30 min. An additional 1 uL DNase was then added and the solution was incubated for another 30 min. An additional 1 ul DNase was added and the solution was incubated for 1 hour. The reactions were cleaned up using Zymo-RNA clean and concentrator-5, per the manufacturer's instructions and then eluted in 20 uL water. The RNA was quantified using a Nanodrop 2000 instrument (Thermo) and the final concentrations were adjusted to 25 ng/ul.
Next, cDNA was synthesized for use in qPCR using the Improm-II Reverse Transcription Kit⢠(Promega). In this procedure, the RNA was primed using random hexamers (0.5 ul) provided in the kit, 10 mM dNTP (0.5 ul), and 4 uL of purified RNA (at 25 ng/ul). The mixture was heated at 70° C. for 5 min., and then quick chilled on ice for 2-3 min. Then, 5 ul of RT or no RT mix was added (at least one no RT control was run, in order to check for DNA contamination). The reverse transcriptase (RT) reaction was performed using 5à RT buffer (2.2 ul), 25 mM MgCl2 (2.2 ul), RNAsin (0.25 ul), water (0.25 ul), and RT (0.5 ul), in a final volume of 5 ul. The mixture was incubated at 25° C. for 5 min, 42° C. for 1 hr, 70° C. for 15 min. After this, reactions were kept at 40 until they were used for qPCR reactions. Next, the cDNA was diluted 1:20 by adding 95 ul water to the 5 ul RT reaction. The qPCR reactions were run in triplicate, using appropriate controls (e.g., at least one no RT reaction and a no template control for each gene tested). The folA and the cysG genes were used as standards for normalization.
The primers sets used were:
DRFR (folA) (endogenous control) DHFR-F TCTGACGCATATCGACGCAGAAGT DHFR-R GCCGCTCCAGAATCTCAAAGCAAT CysG (alternative endogenous control) CysG-F TTGTCGGCGGTGGTGATGTCA CysG-R ATGCGGTGAACTGTGGAATAA FabB FabB3F-ATCTCTGCGTGAAGGACGCGTT FabB3R-ATGAGGCCAGTGGTATCCAG
The qPCR reaction mix contained 2ÃSYBR Master Mix, Roche (10 ul), water (5 ul), 10 uM forward primer (0.5 ul), 10 uM reverse primer (0.5 ul), and cDNA (1:20) (4 ul), to a final volume of 20 ul.
A LightCycler model 480 (Roche) with a 96-well plate was used to carry out the qPCR reactions. Reactions were run at 95° C. for 5 min, followed by 45 cycles of 95° C. for 10 seconds, 60° C. for 10 seconds, and 72° C. for 10 seconds. The melting curve was determined using 95° C. for 5 seconds, followed by 65° C. for 1 min, and a ramp to 95° C. For relative expression analysis, the relative quantitation, 2nd derivative max was used on the Roche480 to determine Cp values. To calculate relative mRNA from Cp values, the efficiency-corrected delta Ct method as described by Bookout et al. was used (See, Bookout et al., âHigh Throughput Real-Time Quantitative Reverse Transcription PCR,â in Current Protocols in Molecular Biology, John Wiley and Sons Inc., Hoboken, N.J., pp., 15.8.1-15.8.28 [2006]).
Example 5 FabB Protein Quantification
In this Example, experiments conducted to quantify the relative amounts of the protein FabB in samples were conducted. In particular, specific peptides of FabB were identified and quantified by LC/MS, using the protocol described below.
Sample Collection:
First, 15 ml aliquots were collected at different time points. In the first step, fatty alcohols produced by the strains were first removed by extracting them by a dodecane wash using 3à dodecane (Sigma) per sample volume, vortexed, and the centrifuged for 10 min at 4000 rpm, 4° C. The supernatants were discarded and the cell pellets were washed with M9YE (without glucose) to wash away residual dodecane. The pellets were stored at â80° C. until further processing.
Cell Lysis:
To lyse the cell pellets, they were thawed on ice, then resuspended in lysis buffer (50 mM Tris pH 8.2, 75 mM NaCl, 8M Urea, containing cOmplete Mini EDTA-free protease inhibitor cocktail (Roche) (1 tablet/10 ml buffer). This buffer also contained 125 U/ml of Benzonase (EMD). Suspensions were sonicated on ice for 30 sec, and 90 sec chill (repeated 3 times). After lysis, the total protein concentrations were determined using the BCS assay following manufacturer recommendations (AMRESCO). The lysates were stored in â80° C. until further use.
In-Solution Digestion:
First, 500 μg of total protein was denatured in the presence of 5 μg of BSA and 5 μg ProteaseMAX surfactant (Promega) in a hot water bath sonicator for an hour, after which the samples were reduced with 5 mM TCEP (Sigma) for 60 minutes at 60° C. followed by alkylation with 15 mM iodoacetic acid (Sigma). This step was done in the dark, at room temperature, for 30 min. Fully denatured, alkylated, and reduced samples were transferred to 10 kDa spin filter columns (Sigma) and twice subjected to 50 mM Tris pH 8.5 buffer exchange. Trypsin was added in a 1:50 enzyme: substrate ratio (on the spin column). Samples were incubated at 37° C. overnight. Peptides were recovered by centrifuging at 15,000 RPM for 15 min. The collected peptides were diluted with 0.1% formic acid solution prior to LC-MS analysis.
LC-MS:
For each LC-MS analysis, 10 μL of sample is loaded onto a Michrom Magic C18 column (3μ, 100 â«, 0.2Ã50 mm) (Michrom). Peptides were detected on the mass spectrometer as they eluted off the column via an MRM method which consisted of tracking transitions as known in the art. Peak areas for each peptide are extracted, and subsequently summed, if they corresponded to the same protein. The amounts of each protein were determined based on normalization of peak areas with respect to spiked BSA.
The sequence of the peptides (and their positions in the protein sequence) identified and used for fabB quantification are shown below:
BSA (GenBank No. P02769): LFTFHADICTLPDTEK (529-544) RPCFSALTPDETYVPK (508-523) E. coli FabB (GenBank No. P0A953) Example 6 Shake Flask Protocol
Most of the commonly used growth media to cultivate E. coli (e.g., M9 and M63), contain excess phosphate, due to the fact that phosphate serves as a buffer in these media. Because of this, to evaluate a phosphate-repressible promoter, a medium containing low phosphate concentration (PMM2) was developed for shake-flask cultures. The composition of this media is shown below:
Final Component Concentration (NH4)2SO4 6 g/L KH2PO4 0.2 g/ L MgSO 4 10 mM Iron (III) citrate 0.1 g/L Thiamine 4.5 mg/L
Strains to be evaluated were first inoculated into 5 ml of 2YT media (16 g/L Bacto tryptone (Difco), 10 g/L Bacto yeast extract (Difco) and 5 g/L NaCL (Sigma), pH 7.0) and grown overnight at 30° C. in a shaker (one inch throw) at 250 rpm. After overnight growth, 2.5 ml were transferred into 50 ml of PMM2 media in 250 ml baffled shake flask (VWR) placed in a shaker at 250 rpm (two inch throw), at 30° C. After three hours of growth, IPTG (1 mM final concentration) was added to induce expression of the FAR enzyme (See, Example 7, below). Then, 280 μl aliquots were removed from each flask (for each strain being evaluated) at specific time points during the course of the experiment (0-72 hrs). Next, 250 ul were transferred to a deep-well plate (VWR) and 1 mL of methyl isobutyl ketone (Sigma) was added to each well and the plate was shaken vigorously (setting at 10 for a desktop plate shaker) for at least 2.5 hrs. The plate was centrifuged at 4000 rpm and 4° C. for 10 min. Then, 200 μl per well was transferred to a 96-well round bottom plate and analyzed via GC-FID to determine the amount and ratio of fatty alcohols produced.
Example 7 Evaluation of fabB Under Control of Pho1 in Shake-Flasks
In this Example, experiments conducted to provide an initial evaluation of the repression of fabB gene expression, under low phosphate conditions are described. In these experiments, the shake flask protocol described in Example 6 was used. The fabB gene was used to illustrate the utility of the present invention. It is not intended that the present invention be limited to expression of any particular gene, as modification(s) in the expression of any suitable gene finds use in the present invention. Plasmid pCDX11-8087 was produced as described in PCT/US12/69553. The sequence of this plasmid is provided below:
GGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTC ACCGTCATCACCGAAACGCGCGAGGCAGCAGATCAATTCGCGCGCGAAGGCGAAGCGGC ATGCATTTACGTTGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCG CCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCG CAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACG TTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCC AACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTC CAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCA ACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAG CGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGG ATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTG ATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGAC TGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGC CCAT TAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATC AAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAA ACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAG ATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATAT CTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTTAACCAC CATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTC TCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAA CCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGC AGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTAATAATTTAAATTGGTTTGA CAGCTTATCATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGC TGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTC CCGTTCTGGATAATGTTTTTTGCGCCGACATAATTGTGAGCGCTCACAATTTCTGAAATG AGCTGTTGACAATTAATCATCCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAAT TTCACACAGGAAACAGCGCCGCTGAGAAAAAGCGAAGCGGCACTGCTCTTTAACAATTT ATCAGACAATCTGTGTGGGCACTCGACCGGAATTATCGATTAACTTTATTATTAAAAATT AAAGGAGGAATAAACCATGGCGACTCAACAACAGAACAACGGTGCATCTGCATCCGGCG TCTTGGAAATTCTTCGTGGAAAGCACGTTCTTATCACAGGTACTACCGGATTTTTGGGCA AAGTGGTTCTGGAAAAGTTGATTCGTACTGTTCCGGATATTGGAGGTATTCATCTGCTGA TTCGTGGCAATAAACGTCATCCAGCCGCTCGCGAACGTTTCCTGAACGAAATTGCGTCCT CCTCCGTCTTCGAACGTTTGCGTCACGATGATAATGAAGCCTTCGAGACCTTCTTGGAAG AACGTGTTCACTGTATTACCGGTGAGATTACTGAATCCCGTTTTGGTTTGACACCTGAGC GTTTTCGTGCTTTGGCCGGTCAGGTTGACGCTTTTATTCATAGCGCTGCAAGCGTGAACTT TCGTGAGCAATTGGATAAAGCCCTGAAAATCAACACCTTGTGTCTTGAAAATGTTGCTGC TCTTGCAGAATTGAACTCCGCTATGGCGGTCATTCAGGTTTCCACTTGTTACGTTAACGGT AAAACCTCCGGTCAAATTACCGAATCCGTCATTAAATCGGTGGCGAATCCATTCCCCGT TCCACTGACGGTTACTACGAGATCGAAGAATTGGTCCATCTGTTGCAAGACAAGATTTCC GATGTTAAAGCTCGTTACTCCGGCCGTGTTATGGGGAAAAAATTGGTTGATTTGGGTATT CGTGAGGCCAATAATTACGGATGGTCCGACACCTACACATTCACCAAATGGTTGGGTGA ACAACTGCTGATGAAGGCCTTGTCTGGTCGTTCTTTGACTATTGTGCGTCCCTCTATTATT GAGTCCGCTTTGGAAGAACCTTCCCCTGGTTGGATCGAAGGCGTTAAAGTTGCCGATGCC ATTATCTTGGCTTATGCCCGTGAAAAAGTTAGCCTGTTCCCTGGAAAACGTTCCGGCATT ATTGATGTTATTCCTGTCGATTTGGTTGCGAACTCCATCATCTTGTCTCTGGCTGAGGCGT TGTCTGGTTCTGGTCAACGTCGTATTTATCAATGTTGCAGCGGTGGTTCTAATCCAATCTC CCTGGGTAAGTTCATTGATTATTTGAACGCCGAGGCTAAGACCAACTATGCTGCCTACGA TCAACTGTTTTATCGTCGTCCTACTAAACCTTTCGTCGCCGTGAACCGTAAATTGTTTGAC GTTGTTGTTGGTGTCATGCGTGTTGTCCTTTCTATTGCCCGCAAAGCTATGCGTTTGGCTG GTGTAAATCGTGAGTTGAAAGTGCTTAAGAACCTTGATACGACCCGTAAACTTGCAACCA TTTTTGGCTTCTATACTGCTCCCGACTATATCTTCCGTAACGATAGCTTGATGGCCCTGGC TCAGCGTATGGGTGAATTGGATCGTGTTCTTTTCCCAGTTGATGCTCGTCAAATTGATTGG CAGTTGTACTTGTGTAAAATTCATTTGCGTGGTCTGAACCGTTACGCTTTGAAGGAACGT AAACTGTATTCTTCGCGTGCTGCTGATACTGACGATAAAACCGCCTAAGTCGACATAGAT CTAGAACTTACTCGGAAGCTTCTTAATTAAGAGGATCCATTGACGTCTATGAATTCGTTT AAACGGTCTCCAGCTTGGCTGTTTTGGCGGATGAGAGAAGATTTTCAGCCTGATACAGAT TAAATCAGAACGCAGAAGCGGTCTGATAAAACAGAATTTGCCTGGCGGCAGTAGCGCGG TGGTCCCACCTGACCCCATGCCGAACTCAGAAGTGAAACGCCGTAGCGCCGATGGTAGT GTGGGGTCTCCCCATGCGAGAGTAGGGAACTGCCAGGCATCAAATAAAACGAAAGGCTC AGTCGAAAGACTGGGCCTTTCGTTTTATCTGTTGTTTGTCGGTGAACGCTCTCCTGAGGCG CCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATATGGTGCACT CTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAACACCC GCTGACGAGCTTAGTAAAGCCCTCGCTAGATTTTAATGCGGATGTTGCGATTACTTCGCC AACTATTGCGATAACAAGAAAAAGCCAGCCTTTCATGATATATCTCCCAATTTGTGTAGG GCTTATTATGCACGCTTAAAAATAATAAAAGCAGACTTGACCTGATAGTTTGGCTGTGAG CAATTATGTGCTTAGTGCATCTAACGCTTGAGTTAAGCCGCGCCGCGAAGCGGCGTCGGC TTGAACGAATTGTTAGACATTATTTGCCGACTACCTTGGTGATCTCGCCTTTCACGTAGTG GACAAATTCTTCCAACTGATCTGCGCGCGAGGCCAAGCGATCTTCTTCTTGTCCAAGATA AGCCTGTCTAGCTTCAAGTATGACGGGCTGATACTGGGCCGGCAGGCGCTCCATTGCCCA GTCGGCAGCGACATCCTTCGGCGCGATTTTGCCGGTTACTGCGCTGTACCAAATGCGGGA CAACGTAAGCACTACATTTCGCTCATCGCCAGCCCAGTCGGGCGGCGAGTTCCATAGCGT TAAGGTTTCATTTAGCGCCTCAAATAGATCCTGTTCAGGAACCGGATCAAAGAGTTCCTC CGCCGCTGGACCTACCAAGGCAACGCTATGTTCTCTTGCTTTTGTCAGCAAGATAGCCAG ATCAATGTCGATCGTGGCTGGCTCGAAGATACCTGCAAGAATGTCATTGCGCTGCCATTC TCCAAATTGCAGTTCGCGCTTAGCTGGATAACGCCACGGAATGATGTCGTCGTGCACAAC AATGGTGACTTCTACAGCGCGGAGAATCTCGCTCTCTCCAGGGGAAGCCGAAGTTTCCAA AAGGTCGTTGATCAAAGCTCGCCGCGTTGTTTCATCAAGCCTTACGGTCACCGTAACCAG CAAATCAATATCACTGTGTGGCTTCAGGCCGCCATCCACTGCGGAGCCGTACAAATGTAC GGCCAGCAACGTCGGTTCGAGATGGCGCTCGATGACGCCAACTACCTCTGATAGTTGAGT CGATACTTCGGCGATCACCGCTTCCCTCATGATGTTTAACTTTGTTTTAGGGCGACTGCCC TGCTGCGTAACATCGTTGCTGCTCCATAACATCAAACATCGACCCACGGCGTAACGCGCT TGCTGCTTGGATGCCCGAGGCATAGACTGTACCCCAAAAAAACAGTCATAACAAGCCAT GAAAACCGCCACTGCGCCGTTACCACCGCTGCGTTCGGTCAAGGTTCTGGACCAGTTGCG TGAGCGCATACGCTACTTGCATTACAGCTTACGAACCGAACAGGCTTATGTCCACTGGGT TCGTGCCTTCATCCGTTTCCACGGTGTGCGTCACCCGGCAACCTTGGGCAGCAGCGAAGT CGAGGCATTTCTGTCCTGGCTGGCGAACGAGCGCAAGGTTTCGGTCTCCACGCATCGTCA GGCATTGGCGGCCTTGCTGTTCTTCTACGGCAAGGTGCTGTGCACGGATCTGCCCTGGCT TCAGGAGATCGGAAGACCTCGGCCGTCGCGGCGCTTGCCGGTGGTGCTGACCCCGGATG AAGTGGTTCGCATCCTCGGTTTTCTGGAAGGCGAGCATCGTTTGTTCGCCCAGCTTCTGTA TGGAACGGGCATGCGGATCAGTGAGGGTTTGCAACTGCGGGTCAAGGATCTGGATTTCG ATCACGGCACGATCATCGTGCGGGAGGGCAAGGGCTCCAAGGATCGGGCCTTGATGTTA CCCGAGAGCTTGGCACCCAGCCTGCGCGAGCAGGGGAATTAATTCCCACGGGTTTTGCTG CCCGCAAACGGGCTGTTCTGGTGTTGCTAGTTTGTTATCAGAATCGCAGATCCGGCTTCA GCCGGTTTGCCGGCTGAAAGCGCTATTTCTTCCAGAATTGCCATGATTTTTTCCCCACGGG AGGCGTCACTGGCTCCCGTGTTGTCGGCAGCTTTGATTCGATAAGCAGCATCGCCTGTTT CAGGCTGTCTATGTGTGACTGTTGAGCTGTAACAAGTTGTCTCAGGTGTTCAATTTCATGT TCTAGTTGCTTTGTTTTACTGGTTTCACCTGTTCTATTAGGTGTTACATGCTGTTCATCTGT TACATTGTCGATCTGTTCATGGTGAACAGCTTTGAATGCACCAAAAACTCGTAAAAGCTC TGATGTATCTATCTTTTTTACACCGTTTTCATCTGTGCATATGGACAGTTTTCCCTTTGATA TGTAACGGTGAACAGTTGTTCTACTTTTGTTTGTTAGTCTTGATGCTTCACTGATAGATAC AAGAGCCATAAGAACCTCAGATCCTTCCGTATTTAGCCAGTATGTTCTCTAGTGTGGTTC GTTGTTTTTGCGTGAGCCATGAGAACGAACCATTGAGATCATACTTACTTTGCATGTCAC TCAAAAATTTTGCCTCAAAACTGGTGAGCTGAATTTTTGCAGTTAAAGCATCGTGTAGTG TTTTTCTTAGTCCGTTATGTAGGTAGGAATCTGATGTAATGGTTGTTGGTATTTTGTCACC ATTCATTTTTATCTGGTTGTTCTCAAGTTCGGTTACGAGATCCATTTGTCTATCTAGTTCA ACTTGGAAAATCAACGTATCAGTCGGGCGGCCTCGCTTATCAACCACCAATTTCATATTG CTGTAAGTGTTTAAATCTTTACTTATTGGTTTCAAAACCCATTGGTTAAGCCTTTTAAACT CATGGTAGTTATTTTCAAGCATTAACATGAACTTAAATTCATCAAGGCTAATCTCTATATT TGCCTTGTGAGTTTTCTTTTGTGTTAGTTCTTTTAATAACCACTCATAAATCCTCATAGAG TATTTGTTTTCAAAAGACTTAACATGTTCCAGATTATATTTTATGAATTTTTTTAACTGGA AAAGATAAGGCAATATCTCTTCACTAAAAACTAATTCTAATTTTTCGCTTGAGAACTTGG CATAGTTTGTCCACTGGAAAATCTCAAAGCCTTTAACCAAAGGATTCCTGATTTCCACAG TTCTCGTCATCAGCTCTCTGGTTGCTTTAGCTAATACACCATAAGCATTTTCCCTACTGAT GTTCATCATCTGAGCGTATTGGTTATAAGTGAACGATACCGTCCGTTCTTTCCTTGTAGGG TTTTCAATCGTGGGGTTGAGTAGTGCCACACAGCATAAAATTAGCTTGGTTTCATGCTCC GTTAAGTCATAGCGACTAATCGCTAGTTCATTTGCTTTGAAAACAACTAATTCAGACATA CATCTCAATTGGTCTAGGTGATTTTAATCACTATACCAATTGAGATGGGCTAGTCAATGA TAATTACTAGTCCTTTTCCTTTGAGTTGTGGGTATCTGTAAATTCTGCTAGACCTTTGCTG GAAAACTTGTAAATTCTGCTAGACCCTCTGTAAATTCCGCTAGACCTTTGTGTGTTTTTTT TGTTTATATTCAAGTGGTTATAATTTATAGAATAAAGAAAGAATAAAAAAAGATAAAAA GAATAGATCCCAGCCCTGTGTATAACTCACTACTTTAGTCAGTTCCGCAGTATTACAAAA GGATGTCGCAAACGCTGTTTGCTCCTTCTACAAAACAGACCTTAAAACCCTAAAGGCTTAAG
The fabB gene is an E. coli gene encodes the FabB enzyme involved in fatty acid biosynthesis. FabB catalyzes the elongation of Acyl-ACPs to chain lengths up to 16 and 18 carbons, in particular unsaturated fatty acids which are essential for membrane formation. As direct readout of the total capacity of fatty acid biosynthesis in a cell, the fatty alcohol reductase (FAR) from Marinobacter algicola was used, as it is known to use Acyl-ACPs to produce fatty alcohols of different chain lengths (See e.g., U.S. Pat. No. 8,216,815). Reduction in FabB elongation capacity in cells where FAR is present, should have at least two effects: (1) a reduction in the total amount of fatty alcohols that the cells can produce; and (2) as the total activity of FabB decreases after the gene has been repressed, a reduction in the chain length of the fatty alcohols produced by FAR should occur. As shown in Table 7-1, after 42 h of incubation, the strain where fabB was being expressed from its native promoter, produced Ë1.6 g/L of fatty alcohols and the percentage of C12:0 fatty alcohol was Ë7%. The strain containing fabB under control of the Pho1 promoter produced only Ë0.9 g/L of fatty alcohols, and Ë47% of the fatty alcohols were C12:0, indicating that the cell's capability to elongate fatty acids was limited.
TABLE 7.1 Fatty Alcohol Production Total Fatty Alcohol % C12:0 Strain Production (g/L) Fatty Alcohols W3110K/pCDX11- ~1.60 ~7 8087 W3100K::Km-Pho1- ~0.9 ~47 fabB/pCDX11-8087 Example 8 Strain Evaluation in 10 L Fermentors
This Example describes experiments developed to collect large samples for mRNA and protein analysis. In these experiments, 10 L cultures were carried out using the conditions described below for each strain:
Strain W3110K/pCDX11-8087:
In an aerated, agitated stirred tank 10 L fermentor, 3 L of growth medium containing 33 g D-glucose monohydrate (Corn Products), 2.6 g ammonium sulfate (Sigma), 10 g Tastone yeast extract (Sensient), 9 g potassium phosphate dibasic anhydrous (Sigma), 3 g sodium citrate dihydrate (Mallinkrodt), 1 g ammonium iron (III) citrate (Alfa Aesar), 50 mg calcium chloride dehydrate (Sigma), 55 mg zinc sulfate heptahydrate (Sigma), 166 mg magnesium sulfate (J.T. Baker), 12.5 mg manganese sulfate heptahydrate (Sigma), 25 mg copper sulfate pentahydrate (Sigma), 2.5 mg ammonium molybdate tetrahydrate (Sigma), 0.5 mg sodium borate decahydrate (Sigma), 25 mg cobalt chloride hexahydrate (Sigma), 3 mL antifoam B (Sigma), and 300 mg spectinomycin (Calbiochem) were brought to a temperature of 30° C. The fermentor was inoculated with 80 mL of a late exponential culture of E. coli. The inoculum was grown in a 1000 mL baffled shake flask containing 100 mL of 10 g/L D-glucose (Sigma). 6 g/L sodium phosphate dibasic anhydrous (Mallinkrodt), 3 g/L potassium phosphate monobasic anhydrous (Mallinkrodt), 1 g/L ammonium chloride (BDH), 2 g/L Tastone yeast extract (Sensient), 0.5 g/L sodium chloride (Sigma), 100 mg/L spectinomycin (Calbiochem) at 30° C., 250 rpm until the OD600 reached 2-3. The fermentor was agitated at 300-1800 rpm and air supplied at 3 slpm to maintain a minimum dissolved oxygen level of 30% of saturation. The pH of the culture was controlled, to maintain it at 7.0 by addition of a solution containing 28-30% ammonia (Sigma) in the form of ammonium hydroxide.
After consumption of the 10 g/L initial glucose, an exponential fed-batch growth phase with a specific growth rate of 0.15 hâ1 (controlled by limiting glucose) was initiated by exponential addition of feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 2 g/L magnesium sulfate to the fermentor. The exponential feed profile was maintained for 10 hours. The expression of the FAR variant was induced at the end of the exponential fed-batch growth phase by the addition of isopropyl-B-D-thiogalactoside (IPTG, Richman Chemical) to a final concentration of 1 mmol/L. Production of fatty alcohol was maintained by a pH-stat protocol using a feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 2 g/L magnesium sulfate (Sigma). The addition of feed solution (60 g of glucose per 1 hour pulse) was triggered when pH spiked above 7.15. In parallel, a 50 g/L potassium phosphate monobasic (Sigma) solution was fed at a constant rate of 0.03 mL/min immediately after IPTG addition until the end of the fermentation. The production of fatty alcohols was maintained for an additional 68 hours at 30° C.
Strain W3110K::Km-Pho1-fabB/pCDX11-8087:
In an aerated, agitated stirred tank 10 L fermentor, 3 L of growth medium containing 29.7 g D-glucose monohydrate (Corn Products), 2.6 g ammonium sulfate (Sigma), 10 g Tastone yeast extract (Sensient), 1.28 g potassium phosphate dibasic anhydrous (Sigma), 3 g sodium citrate dihydrate (Mallinkrodt), 1 g ammonium iron (III) citrate (Alfa Aesar), 50 mg calcium chloride dehydrate (Sigma), 55 mg zinc sulfate heptahydrate (Sigma), 166 mg magnesium sulfate (J.T. Baker), 12.5 mg manganese sulfate heptahydrate (Sigma), 25 mg copper sulfate pentahydrate (Sigma), 2.5 mg ammonium molybdate tetrahydrate (Sigma), 0.5 mg sodium borate decahydrate (Sigma). 25 mg cobalt chloride hexahydrate (Sigma), 3 mL antifoam B (Sigma), and 300 mg spectinomycin (Calbiochem) were brought to a temperature of 30° C. The fermentor was inoculated with 80 mL of a late exponential culture of E. coli. The inoculum was grown in a 1000 mL baffled shake flask containing 100 mL of 10 g/L D-glucose (Sigma), 6 g/L sodium phosphate dibasic anhydrous (Mallinkrodt), 3 g/L potassium phosphate monobasic anhydrous (Mallinkrodt), 1 g/L ammonium chloride (BDH), 2 g/L Tastone yeast extract (Sensient), 0.5 g/L sodium chloride (Sigma), 100 mg/L spectinomycin (Calbiochem) at 30° C., 250 rpm until the OD600 reached 2-3. The fermentor was agitated at 300-1800 rpm and air supplied at 3 slpm to maintain a minimum dissolved oxygen level of 30% of saturation. The pH of the culture was controlled at 7.0 by addition of a solution containing 28-30% ammonia (Sigma) in the form of ammonium hydroxide.
After consumption of the 4.85 mmol/L initial phosphate (as 0.85 g/L potassium phosphate dibasic), an exponential fed-batch growth phase with a specific growth rate of 0.25 h (controlled by limiting phosphate) was initiated by exponential addition of feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 27 g/L potassium phosphate monobasic, 2 g/L magnesium sulfate to the fermentor. The exponential feed profile was maintained for 8.2 hours, allowing 3 cell doubling events under phosphate limiting conditions. The expression of the FAR variant was induced at the end of the exponential fed-batch growth phase by the addition of isopropyl-B-D-thiogalactoside (IPTG, Richman Chemical) to a final concentration of 1 mmol/L. Production of fatty alcohol was maintained by a pH-stat protocol using a feed solution containing 715 g/L D-glucose monohydrate (Corn Products), 2 g/L magnesium sulfate (Sigma). The addition of feed solution (60 g of glucose per 1 hour pulse) was triggered when the pH spiked above 7.15. In parallel, a 50 g/L potassium phosphate monobasic (Sigma) solution was fed at a constant rate of 0.03 mL/min immediately after IPTG addition until the end of the fermentation. The production of fatty alcohols was maintained for another 68 hours at 30° C.
Example 9 Evaluation of fabB Gene Expression Under Control of the Pho1 Promoter in 10 L Fermentors
This Example describes experiments conducted to determine the level of control of the Pho1 promoter in larger fermentors. The experiment described in Example 7 above, indicates that fabB under the Pho1 promoter was repressed by low phosphate conditions. To better control the onset of phosphate limitation and collect larger samples to quantify fabB mRNA and FabB protein, 10 L fermentations were carried out according to the procedures described in Example 8 above using the strains described in Example 7.
Samples were taken at different time points and were used to quantify the relative amount of FabB-specific peptides as described in Example 5 and fabB mRNA relative abundance as described in Example 4. After analysis, the relative amounts of FabB protein or fabB mRNA measured at the onset of the phosphate limitation (12 hours of fermentation) was considered to be 100% and was used to calculate the percentage of FabB protein and fabB mRNA in the samples taken at 24 hours (i.e., 12 hours after phosphate limitation started). These results are shown in Table 9-1.
TABLE 9.1 Relative Concentration of FabB Protein and mRNA After 12 Hours Under Phosphate-Limiting Conditions Relative FabB Protein Relative fabB mRNA Strain Concentration Concentration W3110K/pCDX11-8087 87% 42% W3100K::Km-Pho1- 18% ~1% fabB/pCDX11-8087
As shown in Table 9-1, at 12 hours after phosphate limitation started, both the FabB protein and fabB mRNA were significantly lower in the strain where fabB was under control of the Pho1 promoter.
Example 10 Construction of the Promoter Pho17
As indicated in Example 1, the Pho1 promoter was designed to obtain high levels of expression by using the consensus sequences for the â35 and â10 regions. In some applications, strong promoters are not needed to express a gene. Thus, in this Example, experiments conducted to design a weaker promoter where the â35 region, TTGACA was changed to GTGACA (1 bp change) are described. This new promoter is referred to herein as âPho17.â It is known that mutations in the â35 or â10 regions or in the DNA between these two regions (i.e., the spacer region), can affect drastically promoter strength (See e.g., Moyie et al., J. Bact., 173:1944-1950 [1991]; and U.S. Pat. No. 7,199,233). As shown in FIG. 1 , another consequence of the Pho1 promoter design was that one of the PhoB boxes contained 1 bp that was different from the consensus. The 1 bp change in Pho17 created two PhoB consensus boxes (See, FIG. 1 ). Because of this, it was expected that the Pho17 promoter would be weaker than Pho1 and probably more repressible by PhoBËPi.
The sequences in FIG. 1 are provided below:
GTGACAGATATATGACAGGAATTTGACAGATATATGACAGGCTGGTATAA TGCGCCACCA Pho17: GTGACAGATATATGACAGGAATGTGACAGATATATGACAGGCTGGTATAA TGCGCCACCA
Promoter Pho17 was constructed by mutagenesis of the Km-Pho1 cassette described in Example 2. For such a purpose, this cassette was converted first into a replicating plasmid by ligating it with the R6K origin of replication (R6Kori). The R6Kori was obtained by PCR using the R6KF1 and R6KR1 primers, and plasmid pKD32 obtained from the E. coli Stock Center as template.
5â²âCTGTCAGCCGTTAAGTGTTCCTGTG R6KR1: 5â²âCAGTTCAACCTGTTGATAGTACG
The PCR reaction contained:
Template (10 ng/μl) ââ2 μl 5x HF PHUSIONâ® Buffer â10 μl 10 mM dNTPs ââ1 μl Oligo 50 μM 0.5 μl PHUSIONâ® Polymerase (2 U/μl) 0.5 μl Sterile H2O 36.5 μlâ Total volume: â50 μl
The PCR conditions used were: 1 cycle of 98° C. for 30 seconds, followed by 25 cycles of 98° C. for 30 seconds and 60° C. for 30 seconds, seconds, followed by a final cycle of 72° C. for 2 minutes. This PCR product was purified and ligated to the cassette described in Example 2, using the Quick Ligation kit (New England BioLabs), following the manufacturer's protocol. Ligated products were transformed into PIR1 competent cells accordingly manufacturer recommended procedure (Invitrogen). After transformation, cells were plated on LA (Difco) plates containing 25 ug/ml Km. One colony from these plates was used to purify the plasmid Pho1-R6K.
Plasmid Pho1-R6K was used as template for mutagenesis using the QuikChange kit (Agilent). The oligo (PhoBboxTtoGF) was used to change the nucleotide at the 5â² end of PhoB Box from T to G.
The mutagenesis protocol was carried out as recommended by the supplier, except that in the last step. PIR1 cells were used to transform the mutated plasmid. A plasmid containing the proper modification was identified by sequencing and named pPho17-R6K.
The DNA sequence of the mutated cassette is shown below, with the primer sequence underlined and the modified base in bold within the underlined region.
AGGCGGTGGCTCGATCTTAGCGATGTGTGTAAGGCTGCGCATTCCGGGGA TCCGTCGACCTGCAGTTCGAAGTTCCTATTCTCTAGAAAGTATAGGAACT TCAGAGCGCTTTTGAAGCTCACGCTGCCGCAAGCACTCAGGGCGCAAGGG CTGCTAAAGGAAGCGGAACACGTAGAAAGCCAGTCCGCAGAAACGGTGCT GACCCCGGATGAATGTCAGCTACTGGGCTATCTGGACAAGGGAAAACGCA AGCGCAAAGAGAAAGCAGGTAGCTTGCAGTGGGCTTACATGGCGATAGCT AGACTGGGCGGTTTTATGGACAGCAAGCGAACCGGAATTGCCAGCTGGGG CGCCCTCTGGTAAGGTTGGGAAGCCCTGCAAAGTAAACTGGATGGCTTTC TTGCCGCCAAGGATCTGATGGCGCAGGGGATCAAGATCTGATCAAGAGAC AGGATGAGGATCGTTTCGCATGATTGAACAAGATGGATTGCACGCAGGTT CTCCGGCCGCTTGGGTGGAGAGGCTATTCGGCTATGACTGGGCACAACAG ACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAGGGGCG CCCGGTTCTTTTTGTCAAGACCGACCTGTCCGGTGCCCTGAATGAACTGC AGGACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCCGTTCCTTG CGCAGCTGTGCTCGACGTTGTCACTGAAGCGGGAAGGGACTGGCTGCTAT TGGGCGAAGTGCCGGGGCAGGATCTCCTGTCATCTCACCTTGCTCCTGCC GAGAAAGTATCCATCATGGCTGATGCAATGCGGCGGCTGCATACGCTTGA TCCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGCGAG CACGTACTCGGATGGAAGCCGGTCTTGTCGATCAGGATGATCTGGACGAA GAGCATCAGGGGCTCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGCGCG CATGCCCGACGGCGAGGATCTCGTCGTGACCCATGGCGATGCCTGCTTGC CGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGTGGC CGGCTGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCCGTGA TATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGCTTT ACGGTATCGCCGCTCCCGATTCGCAGCGCATCGCCTTCTATCGCCTTCTT GACGAGTTCTTCTAATAAGGGGATCTTGAAGTTCCTATTCCGAAGTTCCT ATTCTCTAGAAAGTATAGGAACTTCGAAGCAGCTCCAGCCTACAAATAAA AATGCCAGCCGATCGGGCTGGCATTTTTGCCTTTAAATTGGTTTGACAGC TTATCATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATC GGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGT CGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATGTT TGTGACAGATATATGACAGGAATGTGACAGATATATGACAGGCTGGTATA ATGCGCCACCAGAAACTTACTCTATGTGCGACTTACAGAGGT Example 11 Construction of W3110K-Î4 Strain
Experiments conducted to construct the E. coli strain W3110K-D4 are described in this Example. This strain was designed to be suitable for large-scale fermentation processes. The following deletions were made to the starting E. coli W3110K (CGSC) strain: ÎfhuA; ÎldhA; ÎadhE and genes involved in colanic acid biosynthesis Îwza-wcaM. Each of the four deletions was carried out in a two-step process using lambda-RED technology known in the art (See, Datta et al., Gene 379:109-115 [2006]). In the first step, the gene(s) of interest was/were replaced with a dsDNA cassette encoding a kanamycin resistance marker (Km). In the second step, the Km marker was seamlessly removed from the genome using a ssDNA oligo using methods known in the art (See, Datta et al., supra). To exemplify this process, the deletion of the fhuA gene is described below.
For the deletion off fhuA, a dsDNA kanamycin resistance cassette was first PCR amplified from plasmid pKD13 (CGSC) using the following primers:
5â²- ACGTTATCATTCACTTTACATCAGAGATATACCAATGGCGATTCCGGGGA TCCGTCGACC-3â² fhuA-deletion_R: 5â²- AGAGAAATTAGAAACGGAAGGTTGCGGTTGCAACGACCTGTGTAGGCTGG AGCTGCTTCG-3â²
The PCR reaction was carried out using the enzyme PHUSION® DNA polymerase (New England BioLabs) with an initial denaturation step at 98° C. for 30 sec, followed by 30 cycles of the steps: 98° C. for 5 sec, 63° C. for 20 sec and 72° C. for 40 sec. This was followed by a final elongation step at 72° C. for 5 min. After the PCR reaction, the PCR product was purified through a PCR purification column (Qiagen) and eluted with water.
Strain W3110K was transformed with plasmid pSIM5 (Datta et al., supra). Homologous recombination-proficient electrocompetent cells were prepared as described by Datta et al., (supra), and were transformed with 500 ng of the kanamycin cassette from above. Cells were recovered at 32° C. for three hours, plated on LB agar plates containing 20 micrograms/ml of kanamycin, and incubated 24 hours at 32° C. A single colony was streaked onto a fresh LB agar plate with 30 micrograms/ml chloramphenicol (to maintain the pSIM5 plasmid) and a purified colony confirmed to have the fhuA gene replaced with the kanamycin cassette was named W3110K-ÎfhuA::Km.
Next, the kanamycin marker was removed from the above cells using homologous recombination with a ssDNA oligonucleotide. Homologous recombination proficient electrocompetent cells were prepared from strain W3110K-ÎfhuA::Km with the pSIM5 plasmid as described above and the cells were transformed with 500 ng of the oligonucleotide (fhuA(2-10)_del_oligo) shown below. In this sequence, the â*â indicates the presence of phosphorothioate bonds. This oligonucleotide contains four bases that were modified during synthesis of the oligonucleotide by the manufacturer (GenScript). It is known that these modifications make the oligonucleotide resistant to certain cellular nucleases.
5â²- A*G*A*G*AAATTAGAAACGGAAGGTTGCGGTTGCAACGACCTGCGCCAT TGGTATATCTCTGATGTAAAGTGAATGATAACGT-3â²
Cells were recovered at 32° C. for five hours and dilutions were plated on LB agar plates and incubated 24 hours at 32° C. Petri plates with cell dilutions resulting in about 500 colonies/dish were replica plated onto fresh LB (Difco) and LA (Difco) plus kanamycin plates. A kanamycin sensitive colony was struck onto a fresh LA (Difco) plate with 30 micrograms/ml chloramphenicol (to maintain the pSIM5 plasmid) and a purified colony confirmed to have the correct, seamless deletion of the Km cassette, was named W3110K-ÎfhuA.
The subsequent deletions of the ldhA and adhE genes and all the genes of the region wza to wcaM were performed as described above for the fhuA gene. The primers for amplifying the dsDNA cassette from pKD13 and the oligos used for the seamless deletion of the markers, are shown below for each of the ldhA and adhE genes and the wza-wcaM genes:
5â²- AGCTTAAATGTGATTCAACATCACTGGAGAAAGTCTTATGATTCCGGGGA TCCGTCGACC-3â² ldhA-deletion_R: 5â²- ATGCAGGGGAGCGGCAAGATTAAACCAGTTCGTTCGGGCATGTAGGCTGG AGCTGCTTCG-3â² IdhA(1-6)_del_oligo: 5â²- A*G*C*T*TAAATGTGATTCAACATCACTGGAGAAAGTCTTATGTGCCCG AACGAACTGGTTTAATCTTGCCGCTCCCCTGCAT-3â² (* =âphosphorothioate bonds) adhE-deletion_F: 5â²- ATTTACTAAAAAAGTTTAACATTATCAGGAGAGCATTATGATTCCGGGGA TCCGTCGACC-3â² adhE-deletion_R: 5â²- TGCCAGACAGCGCTACTGATTAAGCGGATTTTTTCGCTTTTGTAGGCTGG AGCTGCTTCG-3â² adhE(1-6)_del_oligo: 5â²- A*T*T*T*ACTAAAAAAGTTTAACATTATCAGGAGAGCATTATGAAAGCG AAAAAATCCGCTTAATCAGTAGCGCTGTCTGGCA-3â² (* =âphosphorothioate bonds) wza-deletion_F: 5â²- AGGATAATTACTCTGCCAAAGTGATAAATAAACAATGATGATTCCGGGGA TCCGTCGACC-3â² wcaM-deletion_R: 5â²- GCAATCTAAAGTTAATCTTCTCCACATTAACAATATGGTGTGTAGGCTGG AGCTGCTTCG-3â² wza-wcaM(2-18)_del_oligo: 5â²- G*C*A*A*TCTAAAGTTAATCTTCTCCACATTAACAATATGGTGCATCAT TGTTTATTTATCACTTTGGCAGAGTAATTATCCT-3â² (* =âphosphorothioate bonds)
The final strain was confirmed by DNA sequencing to have seamless deletions of all four loci and was named âW3110K-Î4â (W3110K-ÎfhuA-ÎldhA-ÎadhE-Îwza-wcaM).
Example 12 High Throughput Plate Assay
This Example describes the high throughput plate assays and media M9YE used in the development of the present invention. Medium M9YE has the following composition:
Sodium phosphate dibasic (Sigma) 6 g/L Potassium phosphate monobasic (Sigma) 3 g/L Ammonium chloride (Sigma) 1 g/l Sodium chloride (Omnipur) 0.5 g/L Bis-Tris (Calbiochem) 31.4 g/L Tastone 154AG (Sensient) 2 g/L Glucose (Sigma) 50 (or 10) g/L pH adjusted to 7.0 with NaOH
A single E. coli colony was used to inoculate each well of a 96-well plate filled with 180 ul/well of M9YE media (with 1% glucose and a selection antibiotic). The plate was grown overnight (18-20 hrs) at 30° C., 85% relative humidity and shaking at 200 rpm. Once the cells reached saturation, 5% of the overnight growth was used to inoculate a 96-well plate filled with 380 ul/well of M9YE media containing 5% glucose and the selection antibiotic. The plate was placed in a shaker set to 250 rpm, 30° C. with a two inch throw. After two hours of growth. IPTG (1 mM final concentration) was added to induce the FAR enzyme. The deep-well plate containing the constructs remained in the shaker for Ë72 hrs. 1 mL of methyl isobutyl ketone (MIBK) was added to each well, and the plate was shaken vigorously (setting at 10 for a desktop plate shaker) for at least 2.5 hrs. The plate was centrifuged at 4000 rpm at 4° C. for 10 min. 200 μl per well was transferred to a 96-well round bottom plate and analyzed via GC-FID to evaluate the fatty alcohol total titers and composition.
Example 13 Construction of Strains with fabA Under Control of the Pho1 or Pho17 Promoter
In this Example, experiments conducted to produce E. coli strains with the fabA gene under control of either the Pho1 or Pho17 promoter are described. The fabA gene is an essential E. coli which encodes an enzyme with two catalytic activities, namely a 3-hydroxyl-acyl-ACP dehydratase and a trans-Î2-decenoyl-ACP to cis-Î3-decenoyl-ACP isomerase activity. This isomerase function is essential for the biosynthesis of unsaturated fatty acids. To evaluate the activity of the Pho17 promoter, the Km-Pho17 cassette described in Example 10 was integrated in front of the fabA gene in the chromosome of strain W3110K-Î4 strain (See, Example 11). As a control, the Km-Pho1 cassette (See, Example 2) was cloned in front of fabA in another strain. The Km-Pho1-fabA and Km-Pho17-fabA cassettes were generated by PCR using the pPho1-R6K or pPho17-R6K plasmids (described in Example 10), with primers FabAPhoR and ycgKanF.
GGCCATTACGTTGGCTGAACTGGTTTATTCCGAACTGATCATTCCGGGGA TCCGTCGACC FabAPhoR: GTTTATCTACCATGTTCTCTGTAAGCCTTATTTTATTGAAGTGGTGGCGC ATTATACCAGC
The PCR conditions to generate these cassettes were as described in step 3 of Example 2. These cassettes were integrated in the chromosome of strain W3110K-Î4 strain (See, Example 11) using the protocol described in Example 3. Confirmation of the proper genomic modifications was obtained by PCR (See, Example 3) using the following primers:
TGGCGAAGGCCAAACGACGC fabAseqR: Example 14 Evaluation of Strains Containing fabA Under Control of the Pho1 or Pho17 Promoter
This Example describes experiments to evaluate strains containing fabA under control of either the Pho1 or Pho17 promoter. The strains described in Example 13 were grown according to the plate protocol described in Example 12, and total fatty alcohol (FOH) concentrations and saturation levels were analyzed. As shown in Table 14-1 below, the strains with fabA under control of its native promoter or the Pho1 promoter produced the same amount of fatty alcohols, with very similar saturation levels. The percentage of saturation indicated in this table is the sum of C12:0, C14:0, and C16:0 fatty alcohols. However, the strain with the Pho17-fabA construction produced 25% less fatty alcohols and these fatty alcohols had a higher saturation level. These results indicate that the total capacity to produce fatty acids, as well as the unsaturated fatty acid production level were lower in this strain. Both of these phenotypes would be expected for a lower level of fabA expression, indicating that Pho17 is a weaker promoter than either Pho1 or the native promoter.
TABLE 14-1 Fatty Alcohol Production Total Fatty Percentage of Saturation of Strain Alcohols (g/L) the Fatty Alcohols W3110K-Î4/pCDX11-8087 ~3 53% W3110K-Î4::Km-Pho1- ~3 56% fabA/pCDX11-8087 W3110K-Î4::KmPho17- ~2 73% fabA/pCDX11-8087
While particular embodiments of the present invention have been illustrated and described, it will be apparent to those skilled in the art that various other changes and modifications can be made without departing from the spirit and scope of the present invention. Therefore, it is intended that the present invention encompass all such changes and modifications with the scope of the present invention.
The present invention has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part(s) of the invention. The invention described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is/are not specifically disclosed herein. The terms and expressions which have been employed are used as terms of description and not of limitation. There is no intention that in the use of such terms and expressions, of excluding any equivalents of the features described and/or shown or portions thereof, but it is recognized that various modifications are possible within the scope of the claimed invention. Thus, it should be understood that although the present invention has been specifically disclosed by some embodiments and optional features, modification and variation of the concepts herein disclosed may be utilized by those skilled in the art, and that such modifications and variations are considered to be within the scope of the present invention.
All publications, patents, patent applications and other documents cited in this application are hereby incorporated by reference in their entireties for all purposes to the same extent as if each individual publication, patent, patent application or other document were individually indicated to be incorporated by reference for all purposes.
Claims (7) What is claimed is:
1. A low-phosphate repressible promoter comprising Pho1, wherein said low-phosphate repressible promoter comprises SEQ ID NO: 4.
2. An expression construct comprising at least one low-phosphate repressible promoter provided in claim 1 .
3. A recombinant host cell comprising at least one low-phosphate repressible promoter, wherein said promoter is the low-phosphate repressible promoter set forth in claim 1 .
4. The recombinant host cell of claim 3 , wherein said recombinant host cell is E. coli.
5. The recombinant host cell of claim 3 , wherein said recombinant host cell is present within a culture medium.
6. The recombinant host cell of claim 3 , wherein at least one gene is under the control of the at least one low-phosphate repressible promoter.
7. The recombinant host cell of claim 3 , wherein said recombinant host cell is present within a culture medium and the expression of at least one gene is under the control of the at least one low-phosphate repressible promoter which responds to the phosphate concentration of said culture medium.
US14/773,554 2013-03-14 2014-03-13 Low-phosphate repressible promoter Active 2034-05-11 US9670493B2 (en) Priority Applications (1) Application Number Priority Date Filing Date Title US14/773,554 US9670493B2 (en) 2013-03-14 2014-03-13 Low-phosphate repressible promoter Applications Claiming Priority (3) Application Number Priority Date Filing Date Title US201361783641P 2013-03-14 2013-03-14 US14/773,554 US9670493B2 (en) 2013-03-14 2014-03-13 Low-phosphate repressible promoter PCT/US2014/025332 WO2014159850A2 (en) 2013-03-14 2014-03-13 Low-phosphate repressible promoter Publications (2) Family ID=51625615 Family Applications (1) Application Number Title Priority Date Filing Date US14/773,554 Active 2034-05-11 US9670493B2 (en) 2013-03-14 2014-03-13 Low-phosphate repressible promoter Country Status (4) Families Citing this family (2) * Cited by examiner, â Cited by third party Publication number Priority date Publication date Assignee Title EP2970869A4 (en) 2013-03-14 2016-08-03 Codexis Inc Low-phosphate repressible promoter US20210355552A1 (en) * 2020-05-13 2021-11-18 Brigham Young University Paper-based colorimetric covid-19/sars-cov-2 test Citations (17) * Cited by examiner, â Cited by third party Publication number Priority date Publication date Assignee Title US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme US5304472A (en) 1992-11-20 1994-04-19 Genentech, Inc. Method of controlling polypeptide production in bacterial cells US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides US6117679A (en) 1994-02-17 2000-09-12 Maxygen, Inc. Methods for generating polynucleotides having desired characteristics by iterative selection and recombination US6376246B1 (en) 1999-02-05 2002-04-23 Maxygen, Inc. Oligonucleotide mediated nucleic acid recombination WO2002040679A2 (en) 2000-11-15 2002-05-23 Archer-Daniels-Midland Company Corynebacterium glutamicum promoters US6586182B1 (en) 1996-12-18 2003-07-01 Maxygen, Inc. Methods and compositions for polypeptide engineering US7199233B1 (en) 1996-08-23 2007-04-03 Peter Ruhdal Jensen Artificial promoter libraries for selected organisms and promoters derived from such libraries US20080220990A1 (en) 2002-03-01 2008-09-11 Maxygen, Inc. Methods, systems, and software for identifying functional bio-molecules EP1990416A1 (en) 2006-02-02 2008-11-12 Ajinomoto Co., Inc. Method for production of l-amino acid US20090312196A1 (en) 2008-06-13 2009-12-17 Codexis, Inc. Method of synthesizing polynucleotide variants US20110212508A1 (en) 2008-11-18 2011-09-01 Laxmi Srinivas Rao Novel Synthetic Expression Vehicle US8216815B2 (en) 2009-06-30 2012-07-10 Codexis, Inc. Production of fatty alcohols with fatty alcohol forming acyl-CoA reductases (FAR) WO2013096092A1 (en) 2011-12-20 2013-06-27 Codexis, Inc. Production of saturated fatty alcohols from engineered microorganisms WO2014159850A2 (en) 2013-03-14 2014-10-02 Codexis, Inc. Low-phosphate repressible promoter
Patent Citations (19) * Cited by examiner, â Cited by third party Publication number Priority date Publication date Assignee Title US4683202B1 (en) 1985-03-28 1990-11-27 Cetus Corp US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences US4683195B1 (en) 1986-01-30 1990-11-27 Cetus Corp US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme US5304472A (en) 1992-11-20 1994-04-19 Genentech, Inc. Method of controlling polypeptide production in bacterial cells US6117679A (en) 1994-02-17 2000-09-12 Maxygen, Inc. Methods for generating polynucleotides having desired characteristics by iterative selection and recombination US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides US7199233B1 (en) 1996-08-23 2007-04-03 Peter Ruhdal Jensen Artificial promoter libraries for selected organisms and promoters derived from such libraries US6586182B1 (en) 1996-12-18 2003-07-01 Maxygen, Inc. Methods and compositions for polypeptide engineering US6376246B1 (en) 1999-02-05 2002-04-23 Maxygen, Inc. Oligonucleotide mediated nucleic acid recombination WO2002040679A2 (en) 2000-11-15 2002-05-23 Archer-Daniels-Midland Company Corynebacterium glutamicum promoters US20080220990A1 (en) 2002-03-01 2008-09-11 Maxygen, Inc. Methods, systems, and software for identifying functional bio-molecules EP1990416A1 (en) 2006-02-02 2008-11-12 Ajinomoto Co., Inc. Method for production of l-amino acid US20090312196A1 (en) 2008-06-13 2009-12-17 Codexis, Inc. Method of synthesizing polynucleotide variants US20110212508A1 (en) 2008-11-18 2011-09-01 Laxmi Srinivas Rao Novel Synthetic Expression Vehicle US8216815B2 (en) 2009-06-30 2012-07-10 Codexis, Inc. Production of fatty alcohols with fatty alcohol forming acyl-CoA reductases (FAR) WO2013096092A1 (en) 2011-12-20 2013-06-27 Codexis, Inc. Production of saturated fatty alcohols from engineered microorganisms WO2014159850A2 (en) 2013-03-14 2014-10-02 Codexis, Inc. Low-phosphate repressible promoter Non-Patent Citations (17) * Cited by examiner, â Cited by third party Title Altschul, S., et al., "Basic local alignment search tool," J. Mol. Biol., 215: 403-410 (1990). Altschul, S.F., et al., "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs," Nucleic Acids Res., 25(17):3389-3402 (1997). Blanco, A.G., et al., ",Tandem Dna Recognition by PhoB, a Two-Component Signal Transduction Transcriptional Activator," Structure, 10:701-713 [2002]. Bookout, A.L., et al., "High Throughput Real-Time Quantitative Reverse Transcription PCR," Current Protocols in Molecular Biology, pp. 15.8.1-15.8.28 [2006]. Chenna, R., et al., "Multiple sequence alignment with the Clustal series of programs," Nucl. Acids Res., 31(13):3497-3500 [2003]. Datta, S., et al., "A set of recombineering plasmids for gram-negative bacteria," Gene, 379: 109-115 (2006). Diniz, M.M.P., et al., "Fine-Tuning Control of phoBR Expression in Vibrio cholerae by Binding of PhoB to Multiple Pho Boxes," J. Bact., 193(24): 6929-6938 [2011]. Henikoff, S., et al., "Amino acid substitution matrices from protein blocks," Proc. Natl. Acad. Sci. USA, 89:10915-10919 [1992]. Hsieh, Y.-J., et al., "Global regulation by the seven-component Pi signaling system," Curr. Opin. Microbiol., 13(2):198-203 [2010]. Kimura et al. Regulation of phosphate regulon of Escherichia coli: Characterization of the promoter of the pstS gene. 1989. Molecular Genetics and Genomics. vol. 215, pp. 374-380. * Lübke, C., et al., "Analysis and optimization of recombinant protein production in Escherichia coli using the inducible pho A promoter of the E. coli alkaline phosphatase," Enz. Microb. Technol., 17(10):923-928 [1995]. Moyle, H.,et al., "Hierarchies of base pair preferences in the P22 and promoter," J. Bact., 173:1944-1950 [1991]. Needleman, S., et al., "A general method applicable to the search for similarities in the amino acid sequence of two proteins," J. Mol. Biol. 48:443-453 (1970). Notredame, C., et al., "T-COFFEE: A novel method for multiple sequence alignments," JNB, 302:205-217, [2000]. Pearson, W.R., "Improved tools for biological sequence comparison," Proc. Nat'l. Acad. Sci. USA, 85:2444-2448 (1988). Smith, T., et al., "Comparison of Biosequences," Adv. Appl. Math, 2:482-489 (1981). Yao, N., et al., "Modulation of a Salt Link Does Not Affect Binding of Phosphate to Its Specific Active Transport Receptor," Biochem., 35(7):2079-2085 [1996]. Also Published As Similar Documents Publication Publication Date Title EP3259349B1 (en) 2020-06-17 Dehydrogenase-catalysed production of fdca KR102400332B1 (en) 2022-05-20 Recombinant microorganism for improved production of fine chemicals KR102321146B1 (en) 2021-11-03 Recombinant microorganism for improved production of fine chemicals US9506087B2 (en) 2016-11-29 Glucose and xylose co-utilization in E. coli CA2948382A1 (en) 2016-04-07 Compositions and methods for rapid and dynamic flux control using synthetic metabolic valves US20150218567A1 (en) 2015-08-06 Bacterial Mutants with Improved Transformation Efficiency CN104718282A (en) 2015-06-17 Microorganisms and methods for the production of fatty acids and fatty acid derived products US11746361B2 (en) 2023-09-05 Metabolic engineering for simultaneous consumption of Xylose and glucose for production of chemicals from second generation sugars KR20180011313A (en) 2018-01-31 Recombinant microorganism for improved production of fine chemicals KR20100124332A (en) 2010-11-26 Polypeptide having glyoxalase iii activity, polynucleotide encoding the same and uses thereof US20200115713A1 (en) 2020-04-16 Methods and microorganisms for making 2,3-butanediol and derivatives thereof from c1 carbons JP2017534268A (en) 2017-11-24 Modified microorganisms and methods for the production of useful products WO2021242408A2 (en) 2021-12-02 Methods and compositions for the production of xylitol from xylose utilizing dynamic metabolic control KR101521045B1 (en) 2015-05-15 Recombinant microorganisms for producing organic acids US9670493B2 (en) 2017-06-06 Low-phosphate repressible promoter KR101505172B1 (en) 2015-03-24 3-hydroxypropionic acid-producing recombinant microorganism and method of producing 3-hydroxypropionic acid using the same KR101437041B1 (en) 2014-09-02 Preparation method of succinic acid using recombinant yeast having a resistance to succinic acid EP3011009A1 (en) 2016-04-27 Bacterial mutants with improved transformation efficiency EP2850180A1 (en) 2015-03-25 Bacterial mutants with improved transformation efficiency US20230183757A1 (en) 2023-06-15 Methods and compositions for the production of xylitol from xylose utilizing dynamic metabolic control US11208671B2 (en) 2021-12-28 Recombinant cell and method of producing itaconic acid US20230227769A1 (en) 2023-07-20 Means and Methods to Improve Yeast Fermentation Efficiency KR101494386B1 (en) 2015-02-23 3-hydroxyaldehyde and/or 3-hydroxypropionic acid-producing recombinant microorganism and method of producing 3-hydroxyaldehyde and/or 3-hydroxypropionic acid using the same Legal Events Date Code Title Description 2014-06-19 AS Assignment
Owner name: CODEXIS, INC., CALIFORNIA
Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:VALLE, FERNANDO;CHOUDHARY, PATRICIA;OSBORNE, ROBERT;AND OTHERS;SIGNING DATES FROM 20140401 TO 20140530;REEL/FRAME:033140/0218
2017-05-17 STCF Information on status: patent grant
Free format text: PATENTED CASE
2020-12-07 MAFP Maintenance fee payment
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YR, SMALL ENTITY (ORIGINAL EVENT CODE: M2551); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY
Year of fee payment: 4
2024-02-15 AS Assignment
Owner name: INNOVATUS LIFE SCIENCES LENDING FUND I, LP, AS COLLATERAL AGENT, NEW YORK
Free format text: SECURITY INTEREST;ASSIGNOR:CODEXIS, INC.;REEL/FRAME:066600/0650
Effective date: 20240213
2025-01-27 FEPP Fee payment procedure
Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY
RetroSearch is an open source project built by @garambo
| Open a GitHub Issue
Search and Browse the WWW like it's 1997 | Search results from DuckDuckGo
HTML:
3.2
| Encoding:
UTF-8
| Version:
0.7.4