LucaProt(DeepProtFunc) is an open source project developed by Alibaba and licensed under the Apache License (Version 2.0).
This product contains various third-party components under other open source licenses.
See the NOTICE file for more information.
Notice:
This project provides the Python dependency environment installation file, installation commands, and the running command of the trained LucaProt model for inference or prediction, which can be found in this repository. These models are compatible with Linux, Mac OS, and Windows systems, supporting both CPU and GPU configurations for inference tasks.
2025-05-01
Add the deployable web application (based on flask, in src/app/
)
Start the service on the server,
cd LucaProt/src/app # modify the service port in app.py python app.py
Then the service can be accessed using the browser on the client: http://${server_ip}:8000
2025-04-17:
Add the post-processing workflow to classify the viral RdRPs predicted by LucaProt into our 180 supergroups or novel supergroups.
(Guidance listed in PostProcessingWorkflow.md
or PostProcessingWorkflow_zh.md
of this project).
2024-09-24:
A free CPU version of LucaProt Server
is available online (https://lucaprot.org).
2024-09-01:
Optimize inference and prediction code to run on GPU with small graphics memory, such as A10
.
LucaProt Server(CPU) is available at: https://lucaprot.org.
Limit inference to a maximum of 100 sequences at a time.
The GPU version will come soon.
LucaProt Server
LucaProt: A novel deep learning framework that incorporates protein amino acid sequence and structural information to predict protein function.
We developed a new deep learning model, namely, Deep Sequential and Structural Information Fusion Network for Proteins Function Prediction (DeepProtFunc/LucaProt), which takes into account protein sequence and structural information to facilitate the accurate annotation of protein function.
Here, we applied LucaProt to identify viral RdRP.
We treat protein function prediction as a classification problem. For example, viral RdRP identification is a binary-class classification task, and protein general function annotation is a multi-label classification task. The model includes five modules: Input, Tokenizer, Encoder, Pooling, and Output. Its architecture is shown in Figure 1.
Figure 1 The Architecture of LucaProt
Use the amino acid letter sequence as the input of our model. The model outputs the function label of the input protein, which is a single tag (binary-class classification or multi-class classification) or a set of tags (multi-label classification).
System: Ubuntu 20.04.5 LTS
Python: 3.9.13
Download anaconda: anaconda
Cuda: cuda11.7 (torch==1.13.1)
# Select 'YES' during installation for initializing the conda environment sh Anaconda3-2022.10-Linux-x86_64.sh # Source the environment source ~/.bashrc # Verification conda # Install env and python 3.9.13 conda create -n lucaprot python=3.9.13 # activate env conda activate lucaprot # Install git sudo apt-get update sudo apt install git-all # Enter the project cd LucaProt # Install pip install -r requirements.txt -i https://pypi.tuna.tsinghua.edu.cn/simple
You can simply use this project to infer or predict for unknown sequences.
1) Prediction from one sequencecd LucaProt/src/prediction/
sh run_predict_one_sample.sh
Note: the embedding matrix of the sample is real-time predictive.
Or:
cd LucaProt/src/
# using GPU(cuda=0)
export CUDA_VISIBLE_DEVICES="0,1,2,3"
python predict_one_sample.py \
--protein_id protein_1 \
--sequence MTTSTAFTGKTLMITGGTGSFGNTVLKHFVHTDLAEIRIFSRDEKKQDDMRHRLQEKSPELADKVRFFIGDVRNLQSVRDAMHGVDYIFHAAALKQVPSCEFFPMEAVRTNVLGTDNVLHAAIDEGVDRVVCLSTDKAAYPINAMGKSKAMMESIIYANARNGAGRTTICCTRYGNVMCSRGSVIPLFIDRIRKGEPLTVTDPNMTRFLMNLDEAVDLVQFAFEHANPGDLFIQKAPASTIGDLAEAVQEVFGRVGTQVIGTRHGEKLYETLMTCEERLRAEDMGDYFRVACDSRDLNYDKFVVNGEVTTMADEAYTSHNTSRLDVAGTVEKIKTAEYVQLALEGREYEAVQ \
--emb_dir ./emb/ \
--truncation_seq_length 4096 \
--dataset_name rdrp_40_extend \
--dataset_type protein \
--task_type binary_class \
--model_type sefn \
--time_str 20230201140320 \
--step 100000 \
--threshold 0.5 \
--gpu_id 0
# using CPU(gpu_id=-1)
python predict_one_sample.py \
--protein_id protein_1 \
--sequence MTTSTAFTGKTLMITGGTGSFGNTVLKHFVHTDLAEIRIFSRDEKKQDDMRHRLQEKSPELADKVRFFIGDVRNLQSVRDAMHGVDYIFHAAALKQVPSCEFFPMEAVRTNVLGTDNVLHAAIDEGVDRVVCLSTDKAAYPINAMGKSKAMMESIIYANARNGAGRTTICCTRYGNVMCSRGSVIPLFIDRIRKGEPLTVTDPNMTRFLMNLDEAVDLVQFAFEHANPGDLFIQKAPASTIGDLAEAVQEVFGRVGTQVIGTRHGEKLYETLMTCEERLRAEDMGDYFRVACDSRDLNYDKFVVNGEVTTMADEAYTSHNTSRLDVAGTVEKIKTAEYVQLALEGREYEAVQ \
--emb_dir ./emb/ \
--truncation_seq_length 4096 \
--dataset_name rdrp_40_extend \
--dataset_type protein \
--task_type binary_class \
--model_type sefn \
--time_str 20230201140320 \
--step 100000 \
--threshold 0.5 \
--gpu_id -1
--protein_id
str, the protein id.
--sequence
str, the protein sequence.
--truncation_seq_length
int, truncate sequences longer than the given value. Recommended values: 4096, 2048, 1984, 1792, 1534, 1280, 1152, 1024, default: 4096.
--emb_dir(optional)
path, the saved dirpath of the protein predicted embedding matrix or vector during prediction, optional.
--dataset_name
str, the dataset name for building of our trained model(rdrp_40_extend).
--dataset_type
str, the dataset type for building of our trained model(protein).
--task_type
str, the task type for building of our trained model(binary_class).
--model_type
str, the model name for building of our trained model(sefn).
--time_str
str, the running time string(yyyymmddHimiss) for building of our trained model(20230201140320).
--step
int, the training global step of model finalization(100000).
--threshold
float, sigmoid threshold for binary-class or multi-label classification, None for multi-class classification, default: 0.5.
--gpu_id: int, the gpu id to use(-1 for cpu).
--torch_hub_dir(optional):
str, the torch hub dir path for saving pretrained model(default: ~/.cache/torch/hub/
)
the samples are in *.fasta, sample by sample prediction.
--fasta_file
str, the samples fasta file.
--save_file
str, file path, save the predicted results into the file.
--print_per_number
int, print progress information for every number of samples completed, default: 100.
cd LucaProt/src/prediction/ sh run_predict_many_samples.sh
Or:
cd LucaProt/src/ # using GPU(cuda=0) export CUDA_VISIBLE_DEVICES="0,1,2,3" python predict_many_samples.py \ --fasta_file ../data/rdrp/test/test.fasta \ --save_file ../result/rdrp/test/test_result.csv \ --emb_dir ../emb/ \ --truncation_seq_length 4096 \ --dataset_name rdrp_40_extend \ --dataset_type protein \ --task_type binary_class \ --model_type sefn \ --time_str 20230201140320 \ --step 100000 \ --threshold 0.5 \ --print_per_number 10 \ --gpu_id 0 # using CPU(gpu_id=-1) python predict_many_samples.py \ --fasta_file ../data/rdrp/test/test.fasta \ --save_file ../result/rdrp/test/test_result.csv \ --emb_dir ../emb/ \ --truncation_seq_length 4096 \ --dataset_name rdrp_40_extend \ --dataset_type protein \ --task_type binary_class \ --model_type sefn \ --time_str 20230201140320 \ --step 100000 \ --threshold 0.5 \ --print_per_number 10 \ --gpu_id -13) Prediction from the file(embedding file exists in advance)
The test data (small and real) is in demo.csv, where the 7th column of each line is the filename of the structural embedding information prepared in advance.
And the structural embedding files store in embs.
The test data includes 50 viral-RdRPs and 50 non-viral RdRPs.
cd LucaProt/src/prediction/
sh run_predict_from_file.sh
Or:
cd LucaProt/src/
# using GPU(cuda=0)
export CUDA_VISIBLE_DEVICES="0,1,2,3"
python predict.py \
--data_path ../data/rdrp/demo/demo.csv \
--emb_dir ../data/rdrp/demo/embs/esm2_t36_3B_UR50D \
--dataset_name rdrp_40_extend \
--dataset_type protein \
--task_type binary_class \
--model_type sefn \
--time_str 20230201140320 \
--step 100000 \
--evaluate \
--threshold 0.5 \
--batch_size 16 \
--print_per_batch 100 \
--gpu_id 0
# using CPU(gpu_id=-1)
python predict.py \
--data_path ../data/rdrp/demo/demo.csv \
--emb_dir ../data/rdrp/demo/embs/esm2_t36_3B_UR50D \
--dataset_name rdrp_40_extend \
--dataset_type protein \
--task_type binary_class \
--model_type sefn \
--time_str 20230201140320 \
--step 100000 \
--evaluate \
--threshold 0.5 \
--batch_size 16 \
--print_per_batch 100 \
--gpu_id -1
--data_path
path, the file path of prediction data, including 9 columns mentioned above. The value of Column Label can be null.
--emb_dir
path, the saved dirpath of all sample's structural embedding information prepared in advance.
--dataset_name
str, the dataset name for building of our trained model(rdrp_40_extend).
--dataset_type
str, the dataset type for building of our trained model(protein).
--task_type
str, the task name for building of our trained model(binary_class).
--model_type
str, the model name for building of our trained model(sefn).
--time_str
str, the running time string(yyyymmddHimiss) for building of our trained model(20230201140320).
--step
int, the training global step of model finalization(100000).
--threshold
float, sigmoid threshold for binary-class or multi-label classification, None for multi-class classification, default: 0.5.
--evaluate(optional)
store_true, whether to evaluate the predicted results.
--ground_truth_col_index(optional)
int, the ground truth col index of the ${data_path}, default: None.
--batch size
int, batch size per GPU/CPU for evaluation, default: 16.
--print_per_batch
int, how many batches are completed every time for printing progress information, default: 1000.
--gpu_id: int, the gpu id to use(-1 for cpu).
--torch_hub_dir(optional):
str, the torch hub dir path for saving pretrained model(default: ~/.cache/torch/hub/
)
Note: the embedding matrices of all the proteins in this file need to prepare in advance($emb_dir).
4. 11 independent validation datasets11 verification datasets unrelated to the model building dataset, include 7 exists viral-RdRP datasets and 4 exists non viral-RdRP datasets.
Run the prediction python script https://github.com/alibaba/LucaProt/src/predict_many_samples.py
The performance on these 11 independent verification datasets of LucaProt.
LucaProt-Performance-On-11-Independent-Datasets.xlsx
or LucaProt Figshare
This project is used to predict unlabeled protein sequences and to measure the time spent.
LucaProtApp or LucaProt Figshare
LucaProt is suitably speedy because it only needs to predict the structural representation matrix rather than the complete 3D structure of the protein sequence.
Benchmark: For each sequence length range(total 10 groups), selected 50 viral-RdRPS and 50 non-viral RdRPs for each group for inference time cost calculation.
inference_time_data_of_github.csv
or LucaProt Figshare
Note: The spend time includes the time of the structural representation matrix inference, excludes the time of model loading.
1) GPU(Nvidia A100, Cuda: 11.7)Notice: when the sequence length does not exceed 1024, you can use the 24GB GPU for inference, such as the A10.
Protein Seq Len Range Average Time Maximum Time Minimum Time 300 <= Len < 500 0.20s 0.24s 0.16s 500 <= Len < 800 0.30s 0.39s 0.24s 800 <= Len < 1,000 0.42s 0.46s 0.39s 1,000 <= Len < 1,500 0.59s 0.74s 0.45s 1,500 <= Len < 2,000 0.87s 1.02s 0.73s 2,000 <= Len < 3,000 1.31s 1.69s 1.01s 3,000 <= Len < 5,000 2.14s 2.78s 1.72s 5,000 <= Len < 8,000 3.03s 3.45s 2.65s 8,000 <= Len < 10,000 3.77s 4.24s 3.32s 10,000 <= Len 9.92s 17.66s 4.30s 2) CPU (16 cores, 64G memory of Alibaba Cloud ECS) Protein Seq Len Range Average Time Maximum Time Minimum Time 300 <= Len < 500 3.97s 5.71s 2.77s 500 <= Len < 800 5.78s 7.50s 4.48s 800 <= Len < 1,000 8.23s 9.41s 7.41s 1,000 <= Len < 1,500 11.49s 16.42s 9.22s 1,500 <= Len < 2,000 17.71s 22.36s 14.93s 2,000 <= Len < 3,000 26.97s 36.68s 20.99s 3,000 <= Len < 5,000 45.56s 58.42s 35.82s 5,000 <= Len < 8,000 56.57s 58.17s 55.55s 8,000 <= Len < 10,000 57.76s 58.86s 56.66s 10,000 <= Len 66.49s 76.80s 58.42s 3) CPU (96 cores, 768G memory of Alibaba Cloud ECS) Protein Seq Len Range Average Time Maximum Time Minimum Time 300 <= Len < 500 1.89s 2.55s 1.10s 500 <= Len < 800 2.68s 3.44s 2.13s 800 <= Len < 1,000 3.45s 4.25s 2.65s 1,000 <= Len < 1,500 4.27s 5.90s 3.54s 1,500 <= Len < 2,000 5.81s 7.44s 4.76s 2,000 <= Len < 3,000 8.14s 10.74s 6.37s 3,000 <= Len < 5,000 13.25s 17.69s 10.06s 5,000 <= Len < 8,000 17.03s 18.20s 15.98s 8,000 <= Len < 10,000 17.90s 18.99s 16.92s 10,000 <= Len 25.90s 35.02s 18.66s 7. Dataset for Virus RdRPViral RdRP(Positive: 5,979)
The positive sequence fasta file is in data/rdrp/all_dataset_positive.fasta.zip
all_dataset_positive.fasta.zip
or LucaProt Figshare
Non-viral RdRP(Negative: 229434)
The negative sequence fasta file is in dataset/rdrp/all_dataset_negative.fasta.zip
including:
All structural embedding files of the dataset for model building are available at: embs
All structural embedding files of the prediction data for opening are in the process(because of the amount of data).
All 3D-structure PDB files of the model building dataset and predicted data for opening are in the process (because of the amount of data).
structure vocab
This vocab file is struct_vocab/rdrp_40_extend/protein/binary_class/struct_vocab.txt
struct_vocab.txt
subword-level vocab
The size of the vocab of sequence we use is 20,000.
This vocab file is vocab/rdrp_40_extend/protein/binary_class/subword_vocab_20000.txt
subword_vocab_20000.txt
char-level vocab
This vocab file is vocab/rdrp_40_extend/protein/binary_class/vocab.txt
vocab.txt
Viral RdRP identification is a binary-class classification task, including positive and negative classes, using 0 and 1 to represent a negative and positive sample, respectively. The label list file is dataset/rdrp_40_extend/protein/binary_class/label.txt
label.txt
We constructed a data set with 235,413 samples for model building, which included 5,979 positive samples of known viral RdRPs (i.e. the well-curated RdRP database described in the previous section of Methods), and 229,434 (to maintain a 1:40 ratio for viral RdRP and non-virus RdRPs) negative samples of confirmed non-virus RdRPs. And the non-virus RdRPs contained proteins from Eukaryota DNA dependent RNA polymerase (Eu DdRP, N=1,184), Eukaryota RNA dependent RNA polymerase (Eu RdRP, N=2,233), Reverse Transcriptase (RT, N=48,490), proteins obtained from DNA viruses (N=1,533), non-RdRP proteins obtained from RNA viruses (N=1,574), and a wide array of cellular proteins from different functional categories (N=174,420). We randomly divided the dataset into training, validation, and testing sets with a ratio of 8.5:1:1, which were used for model fitting, model finalization (based on the best F1-score training iteration), and performance reporting (including accuracy, precision, recall, F1-score, and Area under the ROC Curve (AUC)), respectively.
Entire Dataset
This file is dataset/rdrp/all_dataset_with_pdb_emb.csv.zip
all_dataset_with_pdb_emb.csv.zip
or LucaProt Figshare
Training set
This file copy to dataset/rdrp_40_extend/protein/binary_class/train_with_pdb_emb.csv
train_with_pdb_emb.csv
or LucaProt Figshare
Validation set
This file copy to dataset/rdrp_40_extend/protein/binary_class/dev_with_pdb_emb.csv
dev_with_pdb_emb.csv
or LucaProt Figshare
Testing set
This file copy to dataset/rdrp_40_extend/protein/binary_class/test_with_pdb_emb.csv
test_with_pdb_emb.csv
or LucaProt Figshare
One row in all the above files represents one sample. All three files consist of 9 columns, including prot_id, seq, seq_len, pdb_filename, ptm, mean_plddt, emb_filename, label, and source. The details of these columns are as follows:
Note: if using strategy one in structure encoder, the pdb_filename, the ptm, and the mean_plddt can be null.
You can use this project to train models for other tasks, not just the viral RdRP identification tasks.
binary-class classification
The label is 0 or 1 for binary-class classification, such as viral RdRP identification.
multi-class classification
The label is 0~N-1 for multi-class classification, such as the species prediction for proteins.
multi-label classification
The labels form a list of 0~N-1 for multi-label classification, such as Gene Ontology annotation for proteins.
The script structure_from_esm_v1.py
is in the directory "src/protein_structure", and it use ESMFold (esmfold_v1) to predict 3D-Structure of protein.
cd LucaProt/src/protein_structure/
export CUDA_VISIBLE_DEVICES=0
python structure_from_esm_v1.py \
-i data/rdrp/rdrp.fasta \
-o pdbs/rdrp/ \
--num-recycles 4 \
--truncation_seq_length 4096 \
--chunk-size 64 \
--cpu-offload \
--batch_size 1
Parameters:
-i (input filepaths)
-o (save dirpath)
The dir path of saving the predicted 3D-structure data, each protein is stored in a PDB file, and each PDB file is named as "protein_" + an auto-increment id + ".pdb", such as "protein_1.pdb".
The mapping between protein ids and auto-increment ids is stored in the file "result_info.csv" (including: "index", "protein_id(uuid)", "seq_len", "ptm", "mean_plddt") in this dir path.
For failed samples(CUDA out of memory), this script will save their protein ids in the "uncompleted.txt", and you can reduce the value of "truncation_seq_length" and add "--try_failure" for retry.
--batch_size
the batch size of running, default: 1.
--truncation_seq_length
truncate sequences longer than the given value, recommended values: 4096, 2048, 1984, 1792, 1536, 1280, 1152, 1022.
--num-recycles
number of recycles to run.
--chunk-size
chunks axial attention computation to reduce memory usage from O(L^2) to O(L), recommended values: 128, 64, 32.
--try_failure
retry the failed samples when reducing the "truncation_seq_length" value.
cd LucaProt/src/protein_structure/
export CUDA_VISIBLE_DEVICES=0
python structure_from_esm_v1.py \
-name protein_id1,protein_id2 \
-seq VGGLFDYYSVPIMT,LPDSWENKLLTDLILFAGSFVGSDTCGKLF \
-o pdbs/rdrp/ \
--num-recycles 4 \
--truncation_seq_length 4096 \
--chunk-size 64 \
--cpu-offload \
--batch_size 1
Parameters:
The script embedding_from_esmfold.py
is in "src/protein_structure", and it use ESMFold (esm2_t36_3B_UR50D) to predict protein structural embedding matrices or vectors.
cd LucaProt/src/protein_structure/
export CUDA_VISIBLE_DEVICES=0
python embedding_from_esmfold.py \
--model_name esm2_t36_3B_UR50D \
--file data/rdrp.fasta \
--output_dir emb/rdrp/ \
--include per_tok contacts bos \
--truncation_seq_length 4094
Parameters:
--model_name
the model name, default: "esm2_t36_3B_UR50D"
-i/--file (input filepath)
-o/--output_dir (save dirpath)
The dir path of saving the predicted structural embedding data, each protein is stored in a pickle file, and each embedding file is named as "embedding_" + auto-increment id + ".pt", such as "embedding_1.pt".
The mapping between protein ids and auto-increment ids is stored in the file "{}_embed_fasta_id_2_idx.csv"(including: "index", "protein_id(uuid)") in this dir path.
For failed samples(CUDA out of memory), this script will save their protein ids in the "{}_embed_uncompleted.txt", and you can reduce the "truncation_seq_length" value and add "--try_failure" for retry.
--truncation_seq_length
truncate sequences longer than the given value. Recommended values: 4094, 2046, 1982, 1790, 1534, 1278, 1150, 1022.
--include
The embedding matrix or vector type of the predicted structural embedding data, including per_tok, mean, contacts, and bos.
Reference:https://github.com/facebookresearch/esm [Compute embeddings in bulk from FASTA]
cd LucaProt/src/protein_structure/
export CUDA_VISIBLE_DEVICES=0
python embedding_from_esmfold.py \
--model_name esm2_t36_3B_UR50D \
-name protein_id1,protein_id2 \
-seq VGGLFDYYSVPIMT,LPDSWENKLLTDLILFAGSFVGSDTCGKLF \
--output_dir embs/rdrp/test/ \
--include per_tok contacts bos \
--truncation_seq_length 4094
Parameters:
-name
protein ids, comma-concatenation for multi proteins.
-seq
protein sequences, comma-concatenation for multi proteins.
Construct your dataset and randomly divide the dataset into training, validation, and testing sets with a specified ratio, and save the three sets in dataset/${dataset_name}/${dataset_type}/${task_type}
, including train_.csv, dev_.csv, test_*.csv.
The file format can be .csv (must include the header ) or .txt (does not need to have the header).
Each file line is a sample containing 9 columns, including prot_id, seq, seq_len, pdb_filename, ptm, mean_plddt, emb_filename, label, and source.
Colunm seq is the sequence, Colunm pdb_filename is the saved PDB filename for structure encoder strategy 2, Colunm ptm and Column mean_plddt are optional, which are obtained from the 3D-Structure computed model, Colunm emb_filename is the saved embedding filename for structure encoder strategy 1, Column label is the sample class(a single value or a list value of label index or label name). Column source is the sample source (optional).
For example:
like_YP_009351861.1_Menghai_flavivirus,MEQNG...,3416,,,,embedding_21449.pt,1,rdrp
Note: if your dataset takes too much space to load into memory at once,
use "src/data_process/data_preprocess_into_tfrecords_for_rdrp.py" to convert the dataset into "tfrecords". And create an index file: python -m tfrecord.tools.tfrecord2idx xxxx.tfrecords xxxx.index
run.py
the main script for model building.
Parameters
Training
#!/bin/bash export CUDA_VISIBLE_DEVICES=0 DATASET_NAME="rdrp_40_extend" DATASET_TYPE="protein" TASK_TYPE="binary_class" # sequence + structural embeddding MODEL_TYPE="sefn" CONFIG_NAME="sefn_config.json" INPUT_MODE="single" LABEL_TYPE="rdrp" embedding_input_size=2560 embedding_type="matrix" SEQ_MAX_LENGTH="2048" embedding_max_length="2048" TRUNCT_TYPE="right" # none, max, value_attention SEQ_POOLING_TYPE="value_attention" # max, value_attention embedding_pooling_type="value_attention" VOCAB_NAME="subword_vocab_20000.txt" SUBWORD_CODES_NAME="protein_codes_rdrp_20000.txt" MAX_METRIC_TYPE="f1" time_str=$(date "+%Y%m%d%H%M%S") python run.py \ --data_dir ../dataset/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE \ --tfrecords \ --filename_pattern {}_with_pdb_emb.csv \ --dataset_name $DATASET_NAME \ --dataset_type $DATASET_TYPE \ --task_type $TASK_TYPE \ --model_type $MODEL_TYPE \ --subword \ --codes_file ../subword/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/$SUBWORD_CODES_NAME\ --input_mode $INPUT_MODE \ --label_type $LABEL_TYPE \ --label_filepath ../dataset/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/label.txt \ --output_dir ../models/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/$MODEL_TYPE/$time_str \ --log_dir ../logs/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/$MODEL_TYPE/$time_str \ --tb_log_dir ../tb-logs/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/$MODEL_TYPE/$time_str \ --config_path ../config/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/$CONFIG_NAME \ --seq_vocab_path ../vocab/$DATASET_NAME/$DATASET_TYPE/$TASK_TYPE/$VOCAB_NAME\ --seq_pooling_type $SEQ_POOLING_TYPE \ --embedding_pooling_type $embedding_pooling_type \ --do_train \ --do_eval \ --do_predict \ --evaluate_during_training \ --per_gpu_train_batch_size=16 \ --per_gpu_eval_batch_size=16 \ --gradient_accumulation_steps=1 \ --learning_rate=1e-4 \ --num_train_epochs=50 \ --logging_steps=1000 \ --save_steps=1000 \ --overwrite_output_dir \ --sigmoid \ --loss_type bce \ --max_metric_type $MAX_METRIC_TYPE \ --seq_max_length=$SEQ_MAX_LENGTH \ --embedding_max_length=$embedding_max_length \ --trunc_type=$TRUNCT_TYPE \ --no_token_type_embeddings \ --embedding_input_size $embedding_input_size\ --embedding_type $embedding_type \ --shuffle_queue_size 10000 \ --save_all
Configuration file
The configuration files of all methods is in "config/rdrp_40_extend/protein/binary_class/".
If training your model, please put the configuration file in "config/${dataset_name}/${dataset_type}/${task_type}/"
Value meaning in configuration file
referring to "src/SSFN/README.md"
Baselines
LGBM (using the embedding vector: <bos> as the input)
cd src/baselines/
sh run_lgbm.sh
XGBoost (using the embedding vector: <bos> as the input)
cd src/baselines/
sh run_xgb.sh
DNN (using the embedding vector: <bos> as the input)
cd src/baselines/
sh run_dnn.sh
Or:
cd src/training
run_subword_rdrp_emb.sh
Transoformer-Char Level (using the sequence as the input)
cd src/training
sh run_char_rdrp_seq.sh
Transoformer-Subword Level (using the sequence as the input)
cd src/training
sh run_subword_rdrp_seq.sh
DNN2 (VALP + DNN, using the embedding matrix as the input)
cd src/training
run_subword_rdrp_emb_v2.sh
Ours
Ours (the sequence + the 3D-structure)
coming soon...
Ours (the sequence + the embedding matrix)
cd src/training
run_subword_rdrp_sefn.sh
The running information is saved in "logs/${dataset_name}/${dataset_type}/${task_type}/${model_type}/${time_str}/logs.txt".
The information includes the model configuration, model layers, running parameters, and evaluation information.
The checkpoints are saved in "models/${dataset_name}/${dataset_type}/${task_type}/${model_type}/${time_str}/checkpoint-${global_step}/", this directory includes "pytorch_model.bin", "config.json", "training_args.bin", and tokenizer information "sequence" or "strcut". The details are shown in Figure 2.
Figure 2: The File List in Checkpoint Dir Path
The metrics are recorded in "tb-logs/${dataset_name}/${dataset_type}/${task_type}/${model_type}/${time_str}/events.out.tfevents.xxxxx.xxxxx"
run: tensorboard --logdir=tb-logs/${dataset_name}/${dataset_type}/${task_type}/${model_type}/${time_str} --bind_all
The predicted results is saved in "predicts/${dataset_name}/${dataset_type}/${task_type}/${model_type}/${time_str}/checkpoint-${global_step}", including:
The details are shown in Figure 3.
Figure 3: The File List in Prediction Dir Path
Note: when using the saved model to predict, the "logs.txt" and the checkpoint dirpath will be used.
10. Related to the ProjectA conventional approach that clustered all proteins based on their sequence homology.
See ClstrSerch/README.md
for details.
*.py in "src/data_preprocess"
*.py in "src/SSFN"
*.sh in "src/prediction"
including:
run_predict_from_file.sh
run prediction for many samples from a file, the structural embedding information prepared in advance.
run_predict_one_sample.sh
run prediction for one sample from the input.
run_predict_many_samples.sh
run prediction for many samples from the input.
We perform ablation studies on our model by removing specific module(sequence-specific and embedding-specific) one at a time to explore their relative importance.
run_predict_only_seq_from_file.sh
only using the sequence to predict and calculate metrics three positive testing datasets, three negative testing datasets, and our checked RdRPs by prediction SRA.
run_predict_only_emb_from_file.sh
only using the structural embedding to predict and calculate metrics three positive testing datasets, three negative testing datasets, and our checked RdRPs by prediction SRA.
run_predict_seq_emb_from_file.sh
using the sequentail info and the structural embedding to predict and calculate metrics three positive testing datasets, three negative testing datasets, and our checked RdRPs by prediction SRA.
*.py in "src/baselines", using the embedding vector as the input, including:
*.py in "src/deep_baselines", including:
CHEER: HierarCHical taxonomic classification for viral mEtagEnomic data via deep learning(2021). code: CHEER
VirHunter: A Deep Learning-Based Method for Detection of Novel RNA Viruses in Plant Sequencing Data(2022). code: VirHunter
Virtifier: a deep learning-based identifier for viral sequences from metagenomes(2022). code: Virtifier
RNN-VirSeeker: RNN-VirSeeker: A Deep Learning Method for Identification of Short Viral Sequences From Metagenomes. code: RNN-VirSeeker
run_deep_baselines.sh
the script to train deep baseline models.
run_predict_deep_baselines.sh
use trained deep baseline models to predict three positive test datasets, three negative test datasets, and our checked RdRP datasets.
run.py
the main script for training deep baseline models.
statistics
the script to statistic the accuracy in three kinds of test datasets(positive, negative, our checked) after prediction by deep baselines.
*.py in "src/biotoolbox"
*.py in "src/common"
*.sh in "src/training"
*.sh in "src/prediction"
the raw data is in "data/".
the files of the dataset is in "dataset/${dataset_name}/${dataset_type}/${task_type}/".
the configuration file of all methods is in "config/${dataset_name}/${dataset_type}/${task_type}/".
some pictures is in "pics/".
the scripts of pictures ploting is in "src/plot".
the codes and results of Geo information Spider in "src/geo_map".
The open resources of our study ar includes 10 subdirectories: Known_RdRPs
, Benchmark
, Results
, All_Contigs
, All_Protein_Sequences
, SG_predicted_protein_structure_supplementation/
, Serratus
, Self_Sequencing_Proteins
, Self_Sequencing_Reads
, and LucaProt
.
Please refer to README.md or LucaProt Figshare .
LucaProt/
includes some resources related to LucaProt, including dataset for model building(dataset_for_model_building), dataset for_model evaluation(dataset_for_model_evaluation), and our trained model(logs/ and models/).
As mentioned above.
sequential info
1) train_with_pdb_emb.csv
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/
or LucaProt Figshare
2) dev_with_pdb_emb.csv
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/
or LucaProt Figshare
3) test_with_pdb_emb.csv
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/
or LucaProt Figshare
structural info
embs
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/embs/
tfrcords
1) train
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/tfrecords/train/
2) dev
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/tfrecords/dev/
3) test
copy to LucaProt/dataset/rdrp_40_extend/protein/binary_class/tfrecords/test/
7 Positive Testing Datasets
1) Wolf et al., 2020 NM
Reference: Doubling of the known set of RNA viruses by metagenomic analysis of an aquatic virome.
or LucaProt Figshare
2) Edgar et al., 2022 Nature
Reference: Petabase-scale sequence alignment catalyses viral discovery.
or LucaProt Figshare
3) Zayed et al, 2022 Science
Reference: Cryptic and abundant marine viruses at the evolutionary origins of Earth's RNA virome.
or LucaProt Figshare
4) Neri et al., 2022 Cell
Reference: Expansion of the global RNA virome reveals diverse clades of bacteriophages.
or LucaProt Figshare
5) Chen et al., 2022 NM
Reference: RNA viromes from terrestrial sites across China expand environmental viral diversity.
or LucaProt Figshare
6) Olendraite et al., 2023 MBE
Reference: Identification of RNA Virus-Derived RdRp Sequences in Publicly Available Transcriptomic Data Sets.
or LucaProt Figshare
7) This Study
Reference: Artificial intelligence redefines RNA virus discovery.
or LucaProt Figshare
4 Negative Testing Datasets
1) RT
or LucaProt Figshare
2) Eu DdRP
or LucaProt Figshare
sequential info
ours_checked_rdrp_final.csv
or LucaProt Figshare
structural info
embs
PDB
All 3D-structure PDB files of our predicted results for opening are in the process.
The trained model for RdRP identification is available at:
Notice: these files were already downloaded in this GitHub project, so you don't need to download them.
logs
logs
copy to LucaProt/logs/
or LucaProt Figshare
models
models
copy to LucaProt/models/
or LucaProt Figshare
LucaTeam:
Yong He, Zhaorong Li, Xin Hou, Mang Shi, Pan Fang
FTP: The all data of LucaProt is available at the website: Open Resources
Figshare: https://doi.org/10.6084/m9.figshare.26298802.v13
Cell:
https://www.cell.com/cell/fulltext/S0092-8674(24)01085-7
@article {LucaProt,
author = {Xin Hou, Yong He, Pan Fang, Shi-Qiang Mei, Zan Xu, Wei-Chen Wu, Jun-Hua Tian, Shun Zhang, Zhen-Yu Zeng, Qin-Yu Gou, Gen-Yang Xin, Shi-Jia Le, Yin-Yue Xia, Yu-Lan Zhou, Feng-Ming Hui, Yuan-Fei Pan, John-Sebastian Eden, Zhao-Hui Yang, Chong Han, Yue-Long Shu, Deyin Guo, Jun Li, Edward C Holmes, Zhao-Rong Li and Mang Shi},
title = {Using artificial intelligence to document the hidden RNA virosphere},
year = {2024},
doi = {10.1016/j.cell.2024.09.027},
publisher = {Cell Press},
URL = {https://doi.org/10.1016/j.cell.2024.09.027},
eprint = {https://www.cell.com/cell/fulltext/S0092-8674(24)01085-7},
journal = {Cell}
}
RetroSearch is an open source project built by @garambo | Open a GitHub Issue
Search and Browse the WWW like it's 1997 | Search results from DuckDuckGo
HTML:
3.2
| Encoding:
UTF-8
| Version:
0.7.4